SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g19600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g19600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g19600

Feature Type:gene_model
Chromosome:Gm05
Start:23539353
stop:23540837
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27670AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr3:10245338-10253158 FORWARD LENGTH=1841 SoyBaseE_val: 4.00E-22ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0006723GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle hydrocarbon biosynthetic process SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR16212Panther FAMILY NOT NAMED JGI ISS
PTHR16212:SF4Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_F4IWL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein resurrection1 n=1 Tax=Arabidopsis thaliana RepID=F4IWL6_ARATH SoyBaseE_val: 2.00E-19ISS
UniRef100_I1N5I9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5I9_SOYBN SoyBaseE_val: 4.00E-33ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g19600 not represented in the dataset

Glyma05g19600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g094100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g19600.1   sequence type=CDS   gene model=Glyma05g19600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GACAACAACATATCTTCTTGTGCACCTCATATATTGATGCTTACTCTGGAGAAGGTTTGCAAGGCCAGAGTGAGTCAATTCTCTAATAATTTGGTTAGTAATGTATCTTGTGTTTTGCCTCCATCTGTTCACATGGTTAAGTCTGCTGCTTCAAAGTTCCTTTTGGAATGGTTGTTCCAACATGAGCATGAACACCGCCAATGGTCTGCTGCAGTTTCTCTTGGATTAATCTCTAGTTGCCTTCATGTAACAGATCATAAAGAGAGATATCATAACATCACAGGACTTCTTGAGGTATTCTTGTTCAATCCTTTTTGTGTATGTCTATTGTCCCATTTTTTTAAAGATCTTGATTATCTTTATTCTTATCGATATTTATTTCTCAGTCCATATTTAATGCTAGTGGGAGTGGTGAATGACTTAGCTGGTTGGGATATATGGATTTTTCTGTATATGAAGTCTTCTGCATTCATTAATTGTCCACTCTTAGCAAATTGTTTTCATTTGTTATTTTTAAACCTTTCGCTCTCGGCAAATTTGAAAGAGGTTGATGTTACTTGTCTCAACCTATGCTTTCTTAATTTAAGGTATGGTTGA

>Glyma05g19600.1   sequence type=predicted peptide   gene model=Glyma05g19600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DNNISSCAPHILMLTLEKVCKARVSQFSNNLVSNVSCVLPPSVHMVKSAASKFLLEWLFQHEHEHRQWSAAVSLGLISSCLHVTDHKERYHNITGLLEVFLFNPFCVCLLSHFFKDLDYLYSYRYLFLSPYLMLVGVVNDLAGWDIWIFLYMKSSAFINCPLLANCFHLLFLNLSLSANLKEVDVTCLNLCFLNLRYG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo