SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g18326): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g18326): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g18326

Feature Type:gene_model
Chromosome:Gm05
Start:21840526
stop:21841161
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g18326
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34520AT Annotation by Michelle Graham. TAIR10: mitochondrial ribosomal protein S14 | chr2:14548218-14548712 REVERSE LENGTH=164 SoyBaseE_val: 4.00E-50ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005763GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial small ribosomal subunit SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1741 KOG Mitochondrial/chloroplast ribosomal protein S14/S29 JGI ISS
PTHR19836Panther 30S RIBOSOMAL PROTEIN S14 JGI ISS
PTHR19836:SF11Panther RPS14 (MITOCHONDRIAL RIBOSOMAL PROTEIN S14), STRUC JGI ISS
PF00253PFAM Ribosomal protein S14p/S29e JGI ISS
UniRef100_B6VJT6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein S14 n=2 Tax=eudicotyledons RepID=B6VJT6_VITVI SoyBaseE_val: 3.00E-63ISS
UniRef100_I1K234UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K234_SOYBN SoyBaseE_val: 5.00E-71ISS

Expression Patterns of Glyma05g18326
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g18326 not represented in the dataset
Glyma05g18326 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g18326 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g18326
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g18326
>Glyma05g18326.1   sequence type=CDS   gene model=Glyma05g18326   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGACTTTACCACTGTGGAACGACTTTTTGCAAAAAGATGAGGGAGAAACTCAGTAAGAAAGAGATGTCGGATCAGCGAAATATACGAGATCACAAACGCAGATTGCTCGCAGCTAAATATGAATTGAGACGAAAGCTTTATAAAGCCTTTTGTAAAGATTCTGATCTTCCTAGTGATATGCGGGACAAACTTCGTTATAAGTTGTCCAAGTTGCCAATAAATAGTTCCTTTGCACGAGTAAGAAACCGATGTATTTCCACGGGTCGCCCTCATTCCGTATATGAGTTCTTTCGAATTTCTCGTATCGTTTTTCATGGATTAGCATCTCGAGGTCCTTTGATGGGCATAAAGAAATCGTCTTGGTAG
Predicted protein sequences of Glyma05g18326
>Glyma05g18326.1   sequence type=predicted peptide   gene model=Glyma05g18326   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRLYHCGTTFCKKMREKLSKKEMSDQRNIRDHKRRLLAAKYELRRKLYKAFCKDSDLPSDMRDKLRYKLSKLPINSSFARVRNRCISTGRPHSVYEFFRISRIVFHGLASRGPLMGIKKSSW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo