SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g17900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g17900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g17900

Feature Type:gene_model
Chromosome:Gm05
Start:20928053
stop:20931868
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g17900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57870AT Annotation by Michelle Graham. TAIR10: sumo conjugation enzyme 1 | chr3:21428831-21430110 REVERSE LENGTH=160 SoyBaseE_val: 9.00E-105ISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
GO:0019789GO-mf Annotation by Michelle Graham. GO Molecular Function: SUMO ligase activity SoyBaseN/AISS
KOG0424 KOG Ubiquitin-protein ligase JGI ISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF32Panther UBIQUITIN-CONJUGATING ENZYME E2D 2 JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_C6T174UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T174_SOYBN SoyBaseE_val: 4.00E-116ISS
UniRef100_E6NU89UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL03K20.8 protein n=1 Tax=Jatropha curcas RepID=E6NU89_9ROSI SoyBaseE_val: 1.00E-112ISS

Expression Patterns of Glyma05g17900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g17900 not represented in the dataset
Glyma05g17900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g17900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g091100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g17900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g17900
>Glyma05g17900.1   sequence type=CDS   gene model=Glyma05g17900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTGGTATCGCTCGTGGACGCCTCACCGAGGAGCGCAAGTCGTGGCGGAAGAACCATCCCCATGGTTTTGTTGCGAAGCCGGAGACGCTGCCCGATGGAACCGTGAATTTGATGGTGTGGCATTGCACTATTCCCGGGAAGACTGGGACTGATTGGGAGGGTGGCTACTTCCCACTTACGCTGCACTTTAGTGAAGACTACCCTAGCAAGCCTCCAAAGTGTAAATTCCCACAAGGTTTCTTCCACCCTAATGTTTATCCTTCTGGGACTGTTTGCTTGTCTATACTTAACGAGGATAGTGGGTGGAGGCCAGCCATAACAGTTAAGCAAATTCTCGTGGGCATCCAAGACTTACTTGACCAGCCAAATCCTGCTGACCCTGCCCAGACAGAAGGCTATCATCTATTCATCCAGGATGCAGCAGAGTACAAGAGAAGGGTCCGCCAGCAGGCAAAGCAATATCCACCTCTTCTCTAG
Predicted protein sequences of Glyma05g17900
>Glyma05g17900.1   sequence type=predicted peptide   gene model=Glyma05g17900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGGIARGRLTEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPPLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo