SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g17418): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g17418): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g17418

Feature Type:gene_model
Chromosome:Gm05
Start:20089380
stop:20090452
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66920AT Annotation by Michelle Graham. TAIR10: SKU5 similar 17 | chr5:26722963-26725370 FORWARD LENGTH=546 SoyBaseE_val: 4.00E-68ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11709Panther MULTI-COPPER OXIDASE JGI ISS
PTHR11709:SF17Panther SUBFAMILY NOT NAMED JGI ISS
PF07732PFAM Multicopper oxidase JGI ISS
UniRef100_B9S8M0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Multicopper oxidase, putative n=1 Tax=Ricinus communis RepID=B9S8M0_RICCO SoyBaseE_val: 2.00E-76ISS
UniRef100_UPI0002339709UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339709 related cluster n=1 Tax=unknown RepID=UPI0002339709 SoyBaseE_val: 5.00E-121ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g17418 not represented in the dataset

Glyma05g17418 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g082800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g17418.1   sequence type=CDS   gene model=Glyma05g17418   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAGACCTTTCTTCCTTCAGTTTTTATTGGAATTTTGGCTTGCTGGAGTGCTCTCTCGGTTATTGCAGAAGATCGATATCAGTACTTAACATGGGAAATTACTAACGGAACAATTTATCCTCTAGATGTTCCTCAACCGGGCATTCTTATCAATGGTCAATTCACGGGCCCTACAATTGAAGCCATCAGCAATGACAATATCCTTGTGAATGTCATTAACAAGCTAGATGAAAAATTCCTCATCACATGGAATGGAATAAAACAAAGAAGGACATCATGGCAGGATAGAGTTTTAGGAACCAACTGTCCAATCCCTCCCAAAAGCAACTGGACATACAAGTTCCAAGTAAAAGATCAAATTGGAACTTACACTTATTTCCCATCAACCAAAATTCATAAAGCTGCTGGTGGTTTTGGGGGATTCAATGTTGCCCAAAGATCTGTGATATCCATCGCATATCCTGCCCCAGATGGAGAATTCACCTTACTTATTGGAGATTGGTACAAAACCAATCACAAACACTTCATTATATCAGGCTACATAGTAGCAAATACTAATTAG

>Glyma05g17418.1   sequence type=predicted peptide   gene model=Glyma05g17418   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQTFLPSVFIGILACWSALSVIAEDRYQYLTWEITNGTIYPLDVPQPGILINGQFTGPTIEAISNDNILVNVINKLDEKFLITWNGIKQRRTSWQDRVLGTNCPIPPKSNWTYKFQVKDQIGTYTYFPSTKIHKAAGGFGGFNVAQRSVISIAYPAPDGEFTLLIGDWYKTNHKHFIISGYIVANTN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo