SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g17290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g17290): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g17290

Feature Type:gene_model
Chromosome:Gm05
Start:19924134
stop:19938457
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80410AT Annotation by Michelle Graham. TAIR10: tetratricopeptide repeat (TPR)-containing protein | chr1:30227963-30234832 REVERSE LENGTH=897 SoyBaseE_val: 1.00E-83ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PTHR22767Panther N-TERMINAL ACETLYTRANSFERASE-RELATED JGI ISS
PTHR22767:SF2Panther N-TERMINAL ACETLYTRANSFERASE-RELATED JGI ISS
PF07719PFAM Tetratricopeptide repeat JGI ISS
UniRef100_G7IMD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: NMDA receptor-regulated protein n=1 Tax=Medicago truncatula RepID=G7IMD3_MEDTR SoyBaseE_val: 2.00E-85ISS
UniRef100_I1MCL5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MCL5_SOYBN SoyBaseE_val: 4.00E-87ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g17290 not represented in the dataset

Glyma05g17290 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g083200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g17290.1   sequence type=CDS   gene model=Glyma05g17290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTTTTCTTCCTCCAAAAGAGGCCAACCTCTTCAAGCTTATTGTTAAATCCTATGAAACCAAACAATACAAAAAGGGCCTCAAAGCAGCCAATACCATTTTGAAAAAATTTCCTGACCATGGAGAAACTTTATCAATGAAGGGTTTGACATTAAATTGCATGGATCATGGTTCTGAGGCATACGAACTGGTTCGCCAAGGATTGAAGAATGACCTTAAAAGTCATGTTTGCTGGTATGTGTATGGTCTCTTGTATCGGTCAAACAGAGAATATAGGGAAGCAATTAAGTGTTATCGGAATGCACATAAAATAGATCCTGACAATATTGAAATCTCGCGGGACCTATTACTTTTACAGGCACGATTAACAATAAAGGTGAAAGGAAAATCTCTCTCCAGCCTTTTACCGTTTGGAATCTTCCATTACATAGCCAAAGGTCACATCACTGGAGAGTTAGAAGGATGCACTCAAATGCAAGACTTAACTGGCTTTGTGGAGACACGACAACAACTTTTGATGCTCAAGTCAAATCATCGCATGAACTGGATTGGCTTTGCTGTTGCTCATCATTAG

>Glyma05g17290.1   sequence type=predicted peptide   gene model=Glyma05g17290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAFLPPKEANLFKLIVKSYETKQYKKGLKAANTILKKFPDHGETLSMKGLTLNCMDHGSEAYELVRQGLKNDLKSHVCWYVYGLLYRSNREYREAIKCYRNAHKIDPDNIEISRDLLLLQARLTIKVKGKSLSSLLPFGIFHYIAKGHITGELEGCTQMQDLTGFVETRQQLLMLKSNHRMNWIGFAVAHH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo