Glyma05g15130 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g15130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g15130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g15130

Feature Type:	gene_model
Chromosome:	Gm05
Start:	16402621
stop:	16403816
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g15130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42020	AT	Annotation by Michelle Graham. TAIR10: Heat shock protein 70 (Hsp 70) family protein \| chr5:16807697-16810480 REVERSE LENGTH=613	SoyBase	E_val: 6.00E-21	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0010197	GO-bp	Annotation by Michelle Graham. GO Biological Process: polar nucleus fusion	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005788	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum lumen	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016592	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mediator complex	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR19375	Panther	HEAT SHOCK PROTEIN 70KDA	JGI		ISS
PTHR19375:SF1	Panther	HEAT SHOCK PROTEIN 70-RELATED	JGI		ISS
PF00012	PFAM	Hsp70 protein	JGI		ISS
UniRef100_Q39830	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BiP isoform A n=1 Tax=Glycine max RepID=Q39830_SOYBN	SoyBase	E_val: 1.00E-20	ISS
UniRef100_Q39830	UniRef	Annotation by Michelle Graham. Best UniRef hit: BiP isoform A n=1 Tax=Glycine max RepID=Q39830_SOYBN	SoyBase	E_val: 1.00E-20	ISS

Expression Patterns of Glyma05g15130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g15130 not represented in the dataset	Glyma05g15130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g15130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g15130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g15130

Limit To All Plant Sequences

>Glyma05g15130.1   sequence type=CDS   gene model=Glyma05g15130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATAAAAAGGGTATGGAAGATGTTGGATTACACAAGAATCAGATGGATGAGATCGATCTTGTTGGTGGAAGCACAAGGATTCCAAAGGTACGACATCTTTTGAAGGACTACTTTGAAGGAAAAAAGCCAAACAAGGTGCAAAGAAGCATTTTGAGTGAAGAGGGTGGGGAAGAAACCAAAGGTACCTTAGTCTGTAATCTAGCTTTTTTTATTACTTATTACTATGTTGTTCGCTTTCTAATTGTTGTGTGCTCTGGATCCAGATATCCTTCTCCTGGATGTGGCTCCCCTCCCTTTTTATTGAGTTTCAGAATCTTCTTTTGTTTTGTTGTGTCGGGTTTTCATTGTAAGGGATGGCCACTTGAATTTGCTACCCCAGCTACAATGTCTGCTTCTACAGTTGATTGTGCTACAACT

Predicted protein sequences of Glyma05g15130

Limit To All Plant Sequences

>Glyma05g15130.1   sequence type=predicted peptide   gene model=Glyma05g15130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YKKGMEDVGLHKNQMDEIDLVGGSTRIPKVRHLLKDYFEGKKPNKVQRSILSEEGGEETKGTLVCNLAFFITYYYVVRFLIVVCSGSRYPSPGCGSPPFLLSFRIFFCFVVSGFHCKGWPLEFATPATMSASTVDCATT

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain