SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g14780

Feature Type:gene_model
Chromosome:Gm05
Start:15985708
stop:15986167
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04037AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF784) | chr2:1305663-1306136 REVERSE LENGTH=157 SoyBaseE_val: 2.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05617PFAM Protein of unknown function (DUF784) JGI ISS
UniRef100_A8MQF4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein n=1 Tax=Arabidopsis thaliana RepID=A8MQF4_ARATH SoyBaseE_val: 5.00E-08ISS
UniRef100_I1K1Y8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1Y8_SOYBN SoyBaseE_val: 5.00E-89ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g076900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g14780.1   sequence type=CDS   gene model=Glyma05g14780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCACTCAACAACTTGTACGTTGCATTGGCCTTTGCGTTAAGCTTAAATTTGTTGATTAATATGTCTCTATCTTCAGAAACTCCTCAACCGTCCCAGGGTCCTTCCAATTCAAAGCCATTGTCTGCGTACGAAAAATATCTTAGTGATTGTGCAAGCAAGTTGAAGCCACACTGTGGTGAACAAATCTTCTTCAGTGTGTTTGTTGGAAATCAAACGGTTACCAACCGCTGTTGTCTCAGTCTATTGAATGACATGGGAAAAGCCTGCCACACAGACGTCACAAAATATGCAGTGACATTGCCATTGTTCAAGCAGAACCTAACTCAAATTTTAAAGAGGAGTGAGAAGGTGTGGAATGATTGTAGTTCTCGGTTAATTAACTGA

>Glyma05g14780.1   sequence type=predicted peptide   gene model=Glyma05g14780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLNNLYVALAFALSLNLLINMSLSSETPQPSQGPSNSKPLSAYEKYLSDCASKLKPHCGEQIFFSVFVGNQTVTNRCCLSLLNDMGKACHTDVTKYAVTLPLFKQNLTQILKRSEKVWNDCSSRLIN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo