Glyma05g14780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g14780

Feature Type:	gene_model
Chromosome:	Gm05
Start:	15985708
stop:	15986167
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g14780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G04037	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF784) \| chr2:1305663-1306136 REVERSE LENGTH=157	SoyBase	E_val: 2.00E-11	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05617	PFAM	Protein of unknown function (DUF784)	JGI		ISS
UniRef100_A8MQF4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein n=1 Tax=Arabidopsis thaliana RepID=A8MQF4_ARATH	SoyBase	E_val: 5.00E-08	ISS
UniRef100_I1K1Y8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1Y8_SOYBN	SoyBase	E_val: 5.00E-89	ISS

Expression Patterns of Glyma05g14780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g14780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g076900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g14780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g14780

Limit To All Plant Sequences

>Glyma05g14780.1   sequence type=CDS   gene model=Glyma05g14780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCACTCAACAACTTGTACGTTGCATTGGCCTTTGCGTTAAGCTTAAATTTGTTGATTAATATGTCTCTATCTTCAGAAACTCCTCAACCGTCCCAGGGTCCTTCCAATTCAAAGCCATTGTCTGCGTACGAAAAATATCTTAGTGATTGTGCAAGCAAGTTGAAGCCACACTGTGGTGAACAAATCTTCTTCAGTGTGTTTGTTGGAAATCAAACGGTTACCAACCGCTGTTGTCTCAGTCTATTGAATGACATGGGAAAAGCCTGCCACACAGACGTCACAAAATATGCAGTGACATTGCCATTGTTCAAGCAGAACCTAACTCAAATTTTAAAGAGGAGTGAGAAGGTGTGGAATGATTGTAGTTCTCGGTTAATTAACTGA

Predicted protein sequences of Glyma05g14780

Limit To All Plant Sequences

>Glyma05g14780.1   sequence type=predicted peptide   gene model=Glyma05g14780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLNNLYVALAFALSLNLLINMSLSSETPQPSQGPSNSKPLSAYEKYLSDCASKLKPHCGEQIFFSVFVGNQTVTNRCCLSLLNDMGKACHTDVTKYAVTLPLFKQNLTQILKRSEKVWNDCSSRLIN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain