SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g14420

Feature Type:gene_model
Chromosome:Gm05
Start:15473777
stop:15479028
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g14420
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01910AT Annotation by Michelle Graham. TAIR10: sulfite oxidase | chr3:314919-317274 REVERSE LENGTH=393 SoyBaseE_val: 8.00E-127ISS
GO:0006790GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound metabolic process SoyBaseN/AISS
GO:0010477GO-bp Annotation by Michelle Graham. GO Biological Process: response to sulfur dioxide SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008482GO-mf Annotation by Michelle Graham. GO Molecular Function: sulfite oxidase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0030151GO-mf Annotation by Michelle Graham. GO Molecular Function: molybdenum ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR19372Panther SULFITE REDUCTASE JGI ISS
PF00174PFAM Oxidoreductase molybdopterin binding domain JGI ISS
UniRef100_B9RBI9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sulfite reductase, putative n=1 Tax=Ricinus communis RepID=B9RBI9_RICCO SoyBaseE_val: 2.00E-132ISS
UniRef100_I1K1X9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1X9_SOYBN SoyBaseE_val: 1.00E-158ISS

Expression Patterns of Glyma05g14420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g14420
ParalogEvidenceComments
Glyma19g18330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g14420 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g078300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g14420
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g14420
>Glyma05g14420.2   sequence type=CDS   gene model=Glyma05g14420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGATATCTGGATGCTTCCAAAATATTCTGTCACTGCCACGTTGCAGTGTGCAGGTAATCGAAGGACTGCTATGAGCAAGATCAAAACAGTAAAGGGAGTTGGCTGGGATGTTTCTGCTATTGGAAATGCTATTTGGGGTGGTGCCAAATTGTCTGATGTTCTAGAACTTGTTGGAATTCCAAAGTTGACTAGTGTCACTCGATTTGGTGGAAGACATGTGGAATTTATAAGCGTTGATAAGTGCAAGGAGGAAAATGGGGGTCCATACAAGGCTTCAATACCACTCAGTCAGGCCACAAATCCTGAAGCAGATGTTCTACTAGCTTATGAAATGAATGGTGAACCTCTTAACAGGGATCATGGGTATCCATTACGTGTGGTTGTTCCTAGTGTCATTGGGGCCCGGTCTGTTAAATGGCTGGAAGATATCAATATCATTGCAGAAGAATGCCAGGGTTTATTCATGCAAAAGGACTACAAAATGTTTCCACCATCAGTGAATTGGGATAATATTGATTGGTCAACCCGGAGACCGCAAATGGATTTCCCAGTTCAGTGTGTTATATGTTCTCTAGAAGACGTGAGCACAGTAAAGCCTGGGAAGGATCAGGAACGTTTTGCCGTCCAAACTGGCGAAACAGCGTGA
Predicted protein sequences of Glyma05g14420
>Glyma05g14420.2   sequence type=predicted peptide   gene model=Glyma05g14420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDIWMLPKYSVTATLQCAGNRRTAMSKIKTVKGVGWDVSAIGNAIWGGAKLSDVLELVGIPKLTSVTRFGGRHVEFISVDKCKEENGGPYKASIPLSQATNPEADVLLAYEMNGEPLNRDHGYPLRVVVPSVIGARSVKWLEDINIIAEECQGLFMQKDYKMFPPSVNWDNIDWSTRRPQMDFPVQCVICSLEDVSTVKPGKDQERFAVQTGETA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo