SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g14350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g14350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g14350

Feature Type:gene_model
Chromosome:Gm05
Start:15236848
stop:15238031
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30580AT Annotation by Michelle Graham. TAIR10: Phospholipid/glycerol acyltransferase family protein | chr4:14932515-14934489 REVERSE LENGTH=356 SoyBaseE_val: 7.00E-58ISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008654GO-bp Annotation by Michelle Graham. GO Biological Process: phospholipid biosynthetic process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003841GO-mf Annotation by Michelle Graham. GO Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity SoyBaseN/AISS
GO:0016746GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups SoyBaseN/AISS
PTHR10434Panther 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE JGI ISS
PF01553PFAM Acyltransferase JGI ISS
UniRef100_G7JXV9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 1-acyl-sn-glycerol-3-phosphate acyltransferase n=1 Tax=Medicago truncatula RepID=G7JXV9_MEDTR SoyBaseE_val: 4.00E-61ISS
UniRef100_I1K1X7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K1X7_SOYBN SoyBaseE_val: 3.00E-159ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g14350 not represented in the dataset

Glyma05g14350 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g14350.1   sequence type=CDS   gene model=Glyma05g14350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCTTTGGTTAATCTGGGGTGTTTTTGTCTGTTGGTGGGGACTTGTGATGGGTTTATATGTGTTTTTTGGGAGGCTGGCAGCATAGCTACTGTTGTAAAAATGCACTTAAGTACCTCTGGTACTATTGCTCTTATTAATAATACTATATATTTTCTGCCTTCCAAAAAAAAATTTGAAGGATTGGAGAATCTGCCACCTCCAGATACTCCTGCTGTGTATGTTTCAAATCATCAGAGTTTTCTAGACATATATACTCTTCTTACTTTAGGAAGAAGCTTTAAGTTCATAAGCAAGACTGGGATATTCCTCTTTCCAATAATTGGGTGGGCGATGTTTCTTTTGGGCATCATTCCTTTGAAGCGCATGGACAGCCGAAGTCAGCTGGACTACCTTAAACGATGCATGGATCTTATCAAGAAAGGAGCCTCTGTTTTTTTCTTTCCTGAGGGAACACGCAGTAAAGATGGAAGACTAGGCACATTCAAGGTGAGTTTGTGTCAAAAATTTTTAATTAGGAAGTGTGTAGTTAGTTACCGCATATGGAGTGAGAATGCTCTTTGTAGGACACTTTTGTCTCTAGGACTGCGAGTGATCAAGAGTATGTATTTGTTTGAGGAAAAACTTGAAGGCTGGAAGCTAAAATTGATGCTAGCAGGGGAGAAAAGATAG

>Glyma05g14350.1   sequence type=predicted peptide   gene model=Glyma05g14350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PLVNLGCFCLLVGTCDGFICVFWEAGSIATVVKMHLSTSGTIALINNTIYFLPSKKKFEGLENLPPPDTPAVYVSNHQSFLDIYTLLTLGRSFKFISKTGIFLFPIIGWAMFLLGIIPLKRMDSRSQLDYLKRCMDLIKKGASVFFFPEGTRSKDGRLGTFKVSLCQKFLIRKCVVSYRIWSENALCRTLLSLGLRVIKSMYLFEEKLEGWKLKLMLAGEKR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo