Glyma05g14280 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g14280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g14280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g14280

Feature Type:	gene_model
Chromosome:	Gm05
Start:	15053729
stop:	15053926
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g14280

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04760	AT	Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 726 \| chr1:1334760-1336070 FORWARD LENGTH=220	SoyBase	E_val: 3.00E-30	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0048451	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal formation	SoyBase	N/A	ISS
GO:0048453	GO-bp	Annotation by Michelle Graham. GO Biological Process: sepal formation	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR21136	Panther	SNARE PROTEINS	JGI		ISS
PTHR21136:SF46	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_B9SVX6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein, putative n=1 Tax=Ricinus communis RepID=B9SVX6_RICCO	SoyBase	E_val: 3.00E-31	ISS
UniRef100_UPI000233D4D6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D4D6 related cluster n=1 Tax=unknown RepID=UPI000233D4D6	SoyBase	E_val: 3.00E-36	ISS

Expression Patterns of Glyma05g14280

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g14280 not represented in the dataset	Glyma05g14280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g14280 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g14280

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g14280

Limit To All Plant Sequences

>Glyma05g14280.1   sequence type=CDS   gene model=Glyma05g14280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCAGAAGTCTCTGATCTACACGTTCGTGTCGCGGGGAACAGTGATTCTCGCGGAGTACACCGAATTCAGCGGAAACTTCAACTCCAACGCCTTCCAGTGCCTTCAGAAGCTCCCTGCCACCAACAACAAGTTCACCTACAATTGCGCACACACCTTCAATTACCTCGTCGACAATGGCTACAGTATGTTCCTC

Predicted protein sequences of Glyma05g14280

Limit To All Plant Sequences

>Glyma05g14280.1   sequence type=predicted peptide   gene model=Glyma05g14280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQKSLIYTFVSRGTVILAEYTEFSGNFNSNAFQCLQKLPATNNKFTYNCAHTFNYLVDNGYSMFL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain