SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g14261): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g14261): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g14261

Feature Type:gene_model
Chromosome:Gm05
Start:15044301
stop:15052981
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G64790AT Annotation by Michelle Graham. TAIR10: ILITYHIA | chr1:24065232-24081908 REVERSE LENGTH=2610 SoyBaseE_val: 7.00E-34ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PTHR23346Panther TRANSLATIONAL ACTIVATOR GCN1-RELATED JGI ISS
PTHR23346:SF7Panther TRANSLATIONAL ACTIVATOR GCN1-RELATED JGI ISS
UniRef100_G7L2Y0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Translational activator GCN1 n=1 Tax=Medicago truncatula RepID=G7L2Y0_MEDTR SoyBaseE_val: 3.00E-35ISS
UniRef100_I1NCF0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCF0_SOYBN SoyBaseE_val: 7.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g14261 not represented in the dataset

Glyma05g14261 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g14261.1   sequence type=CDS   gene model=Glyma05g14261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATAGTAAGATTCTAATAATAATTATGGTTCAAAACACAATCTTGAATTGGACATCTTATAAGAGCAGTAATTTTATGGCATACTGTGCTCCTCAAAATTTGTCTCGGTGTCTCCCTAAGATTGTTCCCAAATTGACTAAGGTTTTGACTGATACACATCCTAAAGTCCAATCAGCTGGGCAAATGGCCCTTCAACACGTTGGGAGTGTGATAAAGAGTCCAGAAATATCTGGTCTTGTCCCTACTCTACTTAAGGAACTTTGTCATCCTAATGAGCATACAAAATATTCCTTTAATATTCTTCTTCAATTGTGGTATCACTTGCTAAACAATGGGCATTTGAAGAACCTTATGTGGAGACAATAA

>Glyma05g14261.1   sequence type=predicted peptide   gene model=Glyma05g14261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSKILIIIMVQNTILNWTSYKSSNFMAYCAPQNLSRCLPKIVPKLTKVLTDTHPKVQSAGQMALQHVGSVIKSPEISGLVPTLLKELCHPNEHTKYSFNILLQLWYHLLNNGHLKNLMWRQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo