SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g14240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g14240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g14240

Feature Type:gene_model
Chromosome:Gm05
Start:15042703
stop:15043141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74920AT Annotation by Michelle Graham. TAIR10: aldehyde dehydrogenase 10A8 | chr1:28139175-28142573 REVERSE LENGTH=496 SoyBaseE_val: 3.00E-33ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009516GO-cc Annotation by Michelle Graham. GO Cellular Compartment: leucoplast SoyBaseN/AISS
GO:0004028GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-chloroallyl aldehyde dehydrogenase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
PTHR11699Panther ALDEHYDE DEHYDROGENASE-RELATED JGI ISS
PTHR11699:SF45Panther gb def: succinic-semialdehyde dehydrogenase, putative [deinococcus radiodurans] JGI ISS
PF00171PFAM Aldehyde dehydrogenase family JGI ISS
UniRef100_E0YL22UniRef Annotation by Michelle Graham. Best UniRef hit: Betaine aldehyde dehydrogenase n=1 Tax=Glycine max RepID=E0YL22_SOYBN SoyBaseE_val: 4.00E-40ISS
UniRef100_E0YL22UniRef Annotation by Michelle Graham. Most informative UniRef hit: Betaine aldehyde dehydrogenase n=1 Tax=Glycine max RepID=E0YL22_SOYBN SoyBaseE_val: 4.00E-40ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g14240 not represented in the dataset

Glyma05g14240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g14240.1   sequence type=CDS   gene model=Glyma05g14240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTACCTACTAAGGAAGACGTTGATCTTGTTGTCGCTACCGCCAAAGCTGCCCTCTCCCGCAACAAGGGCGTCGATTGGGCCTCCGCTTCCGGCTCCGTTTGGGCTCGCTACCTCCGCGCCATCGCTGCCAAGAAAAAGCCTGAACTAGCAAAACTCGAAGCTATTGACTGTGGAAAATCGGTCGATGAAGCCGCCTGGGACATTGACGATGTTGCCGGTTGCTTTCAGTTCTACGCTGACCTTGCTGAAAAATCGAACGCACAGAAAAAGGCTCAT

>Glyma05g14240.1   sequence type=predicted peptide   gene model=Glyma05g14240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LPTKEDVDLVVATAKAALSRNKGVDWASASGSVWARYLRAIAAKKKPELAKLEAIDCGKSVDEAAWDIDDVAGCFQFYADLAEKSNAQKKAH







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo