SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g13540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g13540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g13540

Feature Type:gene_model
Chromosome:Gm05
Start:14074846
stop:14080653
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16710AT Annotation by Michelle Graham. TAIR10: glycosyltransferase family protein 28 | chr4:9398818-9399618 FORWARD LENGTH=176 SoyBaseE_val: 1.00E-86ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0030259GO-bp Annotation by Michelle Graham. GO Biological Process: lipid glycosylation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
KOG3349 KOG Predicted glycosyltransferase JGI ISS
PTHR12867Panther GLYCOSYL TRANSFERASE-RELATED JGI ISS
PF04101PFAM Glycosyltransferase family 28 C-terminal domain JGI ISS
UniRef100_C6T3X6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3X6_SOYBN SoyBaseE_val: 2.00E-125ISS
UniRef100_G7JC52UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-N-acetylglucosamine transferase subunit ALG13-like protein n=1 Tax=Medicago truncatula RepID=G7JC52_MEDTR SoyBaseE_val: 3.00E-104ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g13540 not represented in the dataset

Glyma05g13540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g086900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g13540.1   sequence type=CDS   gene model=Glyma05g13540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAACGATGACATGACAGAGAGAGTAGTTTTCGTGACCGTAGGGACAACGTGCTTCGATGCTCTCGTCAGAGCCATCGATTCCGACAACGTTAAAAAGGCCTTGTTTGCAAAAGGGTACACTCACCTTCTCATTCAAATGGGTCGTGGATCCTATCTTCCTACTAAGTCTGAAGGAGATGATTGTTCGTTGGCTGTAGACTACTTCACTTTTTCTTCCAGTATTGCAGACCATCTCAGATCAGCTTCTCTAGTCATTAGCCACGCAGGATCAGGTAGCATATTTGAGACCTTGCGGCTGGGCAAACCTTTAGTTGTGGTTGTAAATCAAGATTTGATGGATAATCATCAGAGTGAGCTGGCTGAAGAGCTTGCTGATAGAAAACATCTGTATTGTGCTAGTCCTCAAACACTCCATCAAACTATAGCGGACATGGATTTAAGTTCTCTCCTTCCTTACTCCCCAGGTGATGCTACACCAGTGGCCAAGCATATAAACAGATTCCTTGGTTTTCCTGATGATTGA

>Glyma05g13540.1   sequence type=predicted peptide   gene model=Glyma05g13540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNDDMTERVVFVTVGTTCFDALVRAIDSDNVKKALFAKGYTHLLIQMGRGSYLPTKSEGDDCSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLGKPLVVVVNQDLMDNHQSELAEELADRKHLYCASPQTLHQTIADMDLSSLLPYSPGDATPVAKHINRFLGFPDD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo