Glyma05g135 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g135

Feature Type:	gene_model
Chromosome:	Gm05
Start:	24502
stop:	27259
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g135

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G29810	AT	Annotation by Michelle Graham. TAIR10: COBRA-like protein 2 precursor \| chr3:11728212-11730158 FORWARD LENGTH=441	SoyBase	E_val: 2.00E-72	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF04833	PFAM	COBRA-like protein	JGI		ISS
UniRef100_B9RLK9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein COBRA, putative n=1 Tax=Ricinus communis RepID=B9RLK9_RICCO	SoyBase	E_val: 2.00E-76	ISS
UniRef100_I1JZG6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JZG6_SOYBN	SoyBase	E_val: 2.00E-103	ISS

Expression Patterns of Glyma05g135

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g135 not represented in the dataset	Glyma05g135 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g135

Paralog	Evidence	Comments
Glyma17g08830	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g135 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g019100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g135

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g135

Limit To All Plant Sequences

>Glyma05g135.1   sequence type=CDS   gene model=Glyma05g135   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCTCTGTGGTTTCCAACCGCTGGATCTGTTGTCCCCCGTGGTGACTTCTTTGCCATCTTACTGCTGCCACTGCTCTTGTGCACTACATTCACTTCTACAGAAGCCCATGATGCACTTGATCCAACTGGCAATATTACAATCAAATGGGATGTCATAAGCTGGACTCCAGACGGCTATATTTATAAATCCTTTCTTGCTTGTACAGGCTGTTGTTACAACGTACAATTTTCAACAGTATCGCCATATTCAGGCTCCTGGATGGATACTAGGGTGGACATGGGCAAAAAAGGAAGGGACTGTTCAAGGTTCAAAGGGAACATCCCTCATTGTTGCAAGAAGGACCCAACTGTAGTGGATTTACTGCCCGGAACTCCTTACAACCAGCAGATAGCAAATTGTTGCTCAGGGGGAGTCTTGACCTCATGGGCCCAGGACCCTCAAAATGCAATAAGTTCATTTCAACTAAGTGTTGGTTTAGCTGGAACAACTAACGAAACTGTCAAACTGCCAAAAAAATTTACCCTCAAAGCACCAGGGCCTGTGACCTGGAATGTTACCTGCACATATTCTCAATTCCTGGCTCAGAAGACCCCAACTTGCCTGCATTGGCACGTGAAGCTTCAATATAAAGAGCACTGGAGGGTCAAGATCACAATCACAAATTTCAACTACAGAATGAACTATTCGCAATGGAACCTTGTGGTGCAGCACCCAAACTTTGATAATGTAACGCAGGTTTTCAGCTTTAATTTCAAGCCACTAACACCTTACGAGGGCTTTAAGTAA

Predicted protein sequences of Glyma05g135

Limit To All Plant Sequences

>Glyma05g135.1   sequence type=predicted peptide   gene model=Glyma05g135   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSLWFPTAGSVVPRGDFFAILLLPLLLCTTFTSTEAHDALDPTGNITIKWDVISWTPDGYIYKSFLACTGCCYNVQFSTVSPYSGSWMDTRVDMGKKGRDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCSGGVLTSWAQDPQNAISSFQLSVGLAGTTNETVKLPKKFTLKAPGPVTWNVTCTYSQFLAQKTPTCLHWHVKLQYKEHWRVKITITNFNYRMNYSQWNLVVQHPNFDNVTQVFSFNFKPLTPYEGFK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain