Glyma05g10960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g10960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g10960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g10960

Feature Type:	gene_model
Chromosome:	Gm05
Start:	11344142
stop:	11348635
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g10960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55000	AT	Annotation by Michelle Graham. TAIR10: potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein \| chr5:22318644-22321599 FORWARD LENGTH=298	SoyBase	E_val: 3.00E-120	ISS
GO:0006813	GO-bp	Annotation by Michelle Graham. GO Biological Process: potassium ion transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008076	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: voltage-gated potassium channel complex	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005249	GO-mf	Annotation by Michelle Graham. GO Molecular Function: voltage-gated potassium channel activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG1665	KOG	AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats	JGI		ISS
PTHR11145	Panther	EDP1-RELATED	JGI		ISS
PF00805	PFAM	Pentapeptide repeats (8 copies)	JGI		ISS
PF02214	PFAM	K+ channel tetramerisation domain	JGI		ISS
UniRef100_B9SI86	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BTB/POZ domain-containing protein KCTD9, putative n=1 Tax=Ricinus communis RepID=B9SI86_RICCO	SoyBase	E_val: 3.00E-135	ISS
UniRef100_I1K1T8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1T8_SOYBN	SoyBase	E_val: 4.00E-159	ISS

Expression Patterns of Glyma05g10960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g10960 not represented in the dataset	Glyma05g10960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g10960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g089400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g10960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g10960

Limit To All Plant Sequences

>Glyma05g10960.1   sequence type=CDS   gene model=Glyma05g10960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGGCTTCCAATCCGATTTATCCTCCGCCGTTCGCCTCAACATTGGAGGCAAGAAATTTTGCACCACCACCGATACTCTCACTCAGCGCGAACCCGATTCAATGCTTGCCGCTATGTTCAGTGGCCGCCACACGCTGTGCCAAGATCCTGACAAGGGGTATGTGTTTGTTGATAGGGATGGTAAACACTTTCGGCACATTCTCAATTGGTTAAGGGATGGTGTGGTGCCTACTCTCGAGGAGTCTCAGTACTCAGAGCTGTTGAGGGAGGCTGAGTACTATCAGCTACTTGGGCTTATTGATGGAATCCATTCTGTCCTTAATAAGAAGAATGAAGACGATGAGTTCCATACAGAGTTGACACGAACAGATATCATCAAGTGTATACAATCTGAGAAAGTAAGGTTTCGAGGGGTTAATCTTTCCGGCCTTGACCTCTCTAAACTGGATTTATCTTATGTTGATTTCAGCTATGCTTGTCTTAAAAACGTGTTTTTTTCACGAGCAAACCTTCAATGTGCAAAGTTTCGAGATGTTGATGCCGAGGGCTCCATCTTTCACAATGCAACTTTGCGTGAATGTGAATTTACTGCGGCAAATCTTCGTGGTGCTTTATTGGCTGGTGCATGCCTTCAGAGTGCAAATCTACAAGAGTGTAGAAGGGGTTGGCGGTGGTGA

Predicted protein sequences of Glyma05g10960

Limit To All Plant Sequences

>Glyma05g10960.1   sequence type=predicted peptide   gene model=Glyma05g10960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGFQSDLSSAVRLNIGGKKFCTTTDTLTQREPDSMLAAMFSGRHTLCQDPDKGYVFVDRDGKHFRHILNWLRDGVVPTLEESQYSELLREAEYYQLLGLIDGIHSVLNKKNEDDEFHTELTRTDIIKCIQSEKVRFRGVNLSGLDLSKLDLSYVDFSYACLKNVFFSRANLQCAKFRDVDAEGSIFHNATLRECEFTAANLRGALLAGACLQSANLQECRRGWRW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain