|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G55000 | AT | Annotation by Michelle Graham. TAIR10: potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein | chr5:22318644-22321599 FORWARD LENGTH=298 | SoyBase | E_val: 8.00E-38 | ISS |
| GO:0006813 | GO-bp | Annotation by Michelle Graham. GO Biological Process: potassium ion transport | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0008076 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: voltage-gated potassium channel complex | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0005249 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: voltage-gated potassium channel activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR14136 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PF00805 | PFAM | Pentapeptide repeats (8 copies) | JGI | ISS | |
| UniRef100_B9SI86 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: BTB/POZ domain-containing protein KCTD9, putative n=1 Tax=Ricinus communis RepID=B9SI86_RICCO | SoyBase | E_val: 4.00E-37 | ISS |
| UniRef100_I1K1T6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1T6_SOYBN | SoyBase | E_val: 1.00E-69 | ISS |
|
Glyma05g10930 not represented in the dataset |
Glyma05g10930 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g089700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g10930.1 sequence type=CDS gene model=Glyma05g10930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAAGATGACAGACAGATCAGCAACAGCTGTTCTGTCTTGAACTATGAGCTTAGGAGACTACAATCTACTGATGCTTGCTTAGTAGACTCTAGCTTCTGTGGAGCAGATCTGCGTACTGCACATCTACAGAATGCAGATCTTACCAATGCCAATCTAGAGGGAGCCGTCCTAGAAGGAGCTAATTTGAAGGGTGCAAAACTGAACAAAGCAAACCTGAAGGGTGCAAACCTTCAACGAGCTTATCTTTGTCGTGTCAATCTTCGAGATACAGAATTGGAAGGTGCGAGGCTCGATGGTGCAAATTTGCACGGAGCAATTAGATAA
>Glyma05g10930.1 sequence type=predicted peptide gene model=Glyma05g10930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQDDRQISNSCSVLNYELRRLQSTDACLVDSSFCGADLRTAHLQNADLTNANLEGAVLEGANLKGAKLNKANLKGANLQRAYLCRVNLRDTELEGARLDGANLHGAIR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||