|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G11420 | AT | Annotation by Michelle Graham. TAIR10: eukaryotic translation initiation factor 3A | chr4:6947834-6952053 REVERSE LENGTH=987 | SoyBase | E_val: 5.00E-22 | ISS |
GO:0006413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translational initiation | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0005852 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 3 complex | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0003743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity | SoyBase | N/A | ISS |
UniRef100_G7L0K9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit A n=2 Tax=Medicago truncatula RepID=G7L0K9_MEDTR | SoyBase | E_val: 2.00E-32 | ISS |
UniRef100_UPI000233AA16 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233AA16 related cluster n=1 Tax=unknown RepID=UPI000233AA16 | SoyBase | E_val: 7.00E-43 | ISS |
Glyma05g10327 not represented in the dataset |
Glyma05g10327 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.05g090700 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g10327.1 sequence type=CDS gene model=Glyma05g10327 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGAGTTGACCACATGAAAAATGCTGTGATTTTTTGCAAAAAGAGTCTTGAGTCTGATGGCTTAAGGGATCACTTGGCCAATTTTGCTGAAGAATTAAATAAAGCAAGACAGATGATTTATCCTCCTGATAAGAGATCATCAAAACTTGGAGCTTTACTTCCCTCTTTGTCAGAGGTTGTGGCCAAAGAACACAAGAGGCTTCTTGCTTGA
>Glyma05g10327.1 sequence type=predicted peptide gene model=Glyma05g10327 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRVDHMKNAVIFCKKSLESDGLRDHLANFAEELNKARQMIYPPDKRSSKLGALLPSLSEVVAKEHKRLLA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||