SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g10130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g10130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g10130

Feature Type:gene_model
Chromosome:Gm05
Start:10173327
stop:10183293
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50520AT Annotation by Michelle Graham. TAIR10: Phosphoglycerate mutase family protein | chr3:18748058-18749418 FORWARD LENGTH=230 SoyBaseE_val: 1.00E-91ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
KOG0235 KOG Phosphoglycerate mutase JGI ISS
PTHR23029Panther PHOSPHOGLYCERATE MUTASE JGI ISS
PF00300PFAM Phosphoglycerate mutase family JGI ISS
UniRef100_G7LGD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase n=1 Tax=Medicago truncatula RepID=G7LGD8_MEDTR SoyBaseE_val: 1.00E-106ISS
UniRef100_UPI000233AA14UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AA14 related cluster n=1 Tax=unknown RepID=UPI000233AA14 SoyBaseE_val: 4.00E-172ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g10130 not represented in the dataset

Glyma05g10130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g080500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g10130.2   sequence type=CDS   gene model=Glyma05g10130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCACCGATTCCCTTCCCAGCTATCCCCATCCAGATTATGCCGAGATTGTTGTGGTGCGTCACGGTGAAACAGCTTGGAATTCCCAGGGAAGAGTTCAGGGACAAGTGGATATTGAATTAAATGAAACTGGAAGACAACAAGCAGTTGCTGTGGCTAATAGACTATCCAGGGAACCAAAGATCTCTGCTATATATTCTTCTGACCTTCAACGGGCTTTTGAAACAGCACAGATAATTGCAGTCAAATGTGGAGGGCTAGAGGTTGTCAAGGATTTGGACCTAAGAGAAAGACACATGGGGGATCTTCAAGGCCATCCTTATCGTGAATTAGCAACAACTAATCCCATAGGTTACGAGGCTTTGGAGTCTAAGAATGATGATCGAGAGCTCCCTGGTGGTGGAGAAAGTTTTGTTCAACTGTTTGAACGCTGCAAATCTGCGTTGCTGAAAATTGGAAGAAAACATAAAGGGGAGCGAGTTGTTGTTGTCACTCATGGGGCATCCATCGAAACTCTTTACAGGTGGGCCAATGCAACAGGAAGGTATAAAGGGAAAATAGACAATGCATCCATCGCTGTTTTTCGCTTGTACGGTGAGGATAAATGGACCTTAAATATGAAGGGTGATGTTAGCCATCTGTGCCATAATGGATTTCTGCAACCTGGTTTTGAGGGTGACACAACTACTACTTAG

>Glyma05g10130.2   sequence type=predicted peptide   gene model=Glyma05g10130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTDSLPSYPHPDYAEIVVVRHGETAWNSQGRVQGQVDIELNETGRQQAVAVANRLSREPKISAIYSSDLQRAFETAQIIAVKCGGLEVVKDLDLRERHMGDLQGHPYRELATTNPIGYEALESKNDDRELPGGGESFVQLFERCKSALLKIGRKHKGERVVVVTHGASIETLYRWANATGRYKGKIDNASIAVFRLYGEDKWTLNMKGDVSHLCHNGFLQPGFEGDTTTT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo