SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g09251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g09251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g09251

Feature Type:gene_model
Chromosome:Gm05
Start:9011900
stop:9015504
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g09251
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11120AT Annotation by Michelle Graham. TAIR10: translation elongation factor Ts (EF-Ts), putative | chr4:6778066-6779934 FORWARD LENGTH=395 SoyBaseE_val: 2.00E-45ISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003746GO-mf Annotation by Michelle Graham. GO Molecular Function: translation elongation factor activity SoyBaseN/AISS
PTHR11741Panther ELONGATION FACTOR TS JGI ISS
PF00889PFAM Elongation factor TS JGI ISS
UniRef100_I1N5M3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Elongation factor Ts, mitochondrial n=1 Tax=Glycine max RepID=I1N5M3_SOYBN SoyBaseE_val: 5.00E-67ISS
UniRef100_UPI000233AA07UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233AA07 related cluster n=1 Tax=unknown RepID=UPI000233AA07 SoyBaseE_val: 2.00E-78ISS

Expression Patterns of Glyma05g09251
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g09251 not represented in the dataset
Glyma05g09251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g09251
ParalogEvidenceComments
Glyma19g00800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g09251 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g001300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g09251
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g09251
>Glyma05g09251.1   sequence type=CDS   gene model=Glyma05g09251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGTAGTTGCAGCAAAGCCATTATTTTTAACAAAGGAACTTGTACCTTCAGATGCATTAGAAAATGAGCGGGAAATTCTTAAATCTCAGTTTTTGGCAGAAGCCTCTGGTAAGCCTCAGATGGCCATAGAGAAAATGGTTGAAGGACGTCTCCGCAAGTATTTTGAGAATGCAGTATTTATGGACCAAAAGTTTATTATGAATGATACTATGAATGTGAAGGCGGTGCTGGATAATCTATCCAAGGAGGTGGGTTCATCTGTGAGGGTTGTTGACTTTCTCGGAATGGAAGTCAGGGAAGGAATTGCAAGGCAAGAAACAGATAGATCTGAGACTGTTGCTCAGGTTGCGTAA
Predicted protein sequences of Glyma05g09251
>Glyma05g09251.1   sequence type=predicted peptide   gene model=Glyma05g09251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHVVAAKPLFLTKELVPSDALENEREILKSQFLAEASGKPQMAIEKMVEGRLRKYFENAVFMDQKFIMNDTMNVKAVLDNLSKEVGSSVRVVDFLGMEVREGIARQETDRSETVAQVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo