SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g08440

Feature Type:gene_model
Chromosome:Gm05
Start:8338136
stop:8340331
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g08440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26695AT Annotation by Michelle Graham. TAIR10: Ran BP2/NZF zinc finger-like superfamily protein | chr2:11365275-11365789 FORWARD LENGTH=138 SoyBaseE_val: 2.00E-62ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23111Panther ZINC FINGER PROTEIN JGI ISS
PF00641PFAM Zn-finger in Ran binding protein and others JGI ISS
UniRef100_G7JVA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein-like Ser/Thr protein kinase-like protein n=1 Tax=Medicago truncatula RepID=G7JVA8_MEDTR SoyBaseE_val: 6.00E-75ISS
UniRef100_I1K1F0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1F0_SOYBN SoyBaseE_val: 1.00E-91ISS

Expression Patterns of Glyma05g08440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g08440
ParalogEvidenceComments
Glyma17g12571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g08440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g008600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g08440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g08440
>Glyma05g08440.1   sequence type=CDS   gene model=Glyma05g08440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTGGTCTGGGGGAGATTGGATGTGTGGTGTTTGCGAACACATAAATTTCAAGAAGAGGGAAGCATGCCAGAGTTGTGGATACCCCAAGTATGGGGGACCTGACCCTTCAACCTACAGATACAACAGGACTGAAGCTTTGCCAGGGGACTGGTTTTGCAACTGTGGAGCTCACAACTATGCGAATCGATCAAGCTGCTACAGATGTGGCTCAATGAAAGATGATTACTCTTCAGGATATGGCAACAACTCTGGAGGATATGGATCTGACACTTTCCCCCCAGGATGGAAGACTGGAGACTGGCTTTGCCCAAGACATGGATGTGGAGTGCATAATTATGCTAGCAGGACAGAATGCTATAAATGCAAAATGCCAAGGGATTATGGTGGTGCTGACTGA
Predicted protein sequences of Glyma05g08440
>Glyma05g08440.1   sequence type=predicted peptide   gene model=Glyma05g08440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSWSGGDWMCGVCEHINFKKREACQSCGYPKYGGPDPSTYRYNRTEALPGDWFCNCGAHNYANRSSCYRCGSMKDDYSSGYGNNSGGYGSDTFPPGWKTGDWLCPRHGCGVHNYASRTECYKCKMPRDYGGAD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo