Glyma05g08400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g08400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g08400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g08400

Feature Type:	gene_model
Chromosome:	Gm05
Start:	8321606
stop:	8325116
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g08400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25940	AT	Annotation by Michelle Graham. TAIR10: early nodulin-related \| chr5:9054252-9055151 REVERSE LENGTH=115	SoyBase	E_val: 2.00E-17	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03386	PFAM	Early nodulin 93 ENOD93 protein	JGI		ISS
UniRef100_A3FGC9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin 93 protein n=1 Tax=Populus alba x Populus tremula var. glandulosa RepID=A3FGC9_9ROSI	SoyBase	E_val: 2.00E-53	ISS
UniRef100_I1K1E6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1K1E6_SOYBN	SoyBase	E_val: 3.00E-70	ISS

Expression Patterns of Glyma05g08400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g08400 not represented in the dataset	Glyma05g08400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g08400

Paralog	Evidence	Comments
Glyma17g12610	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g08400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g08400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma05g08400

Limit To All Plant Sequences

>Glyma05g08400.3   sequence type=transcript   gene model=Glyma05g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGCAACTTCAGCAACTCTTCATCCAAAGCTTCTTCAGTTATTCATCTGCTTACTAAAATTTCTTCCATTCTTAGCTTTGTTCAATCAAAGTTTTTTAAGATGGCCCAGAGAAATGTTACTGCTAATTCTTCTTTTGAAAGGACTAGCTTGCCTTCCCTAGATCAAAAGTTGGCCATGGCCAAGCGCTGCTCTCATGAGGGTGTGATGGCAGGAGCCAAGGCAGCTGTTGTTGCTACTATTGCCACTGCCATTCCAACTCTCGCTAGTGTAAGGACAATACCTTGGGCAAGAGCCAATCTCAATCCCACTGCTCAAGCTCTCATAATTTCCACAGGTAATTACTTATCCACAGTGCTGTCATTATCTCCTCATAATCATTACAATCATTGTTCCAATTAGTCATCTAACCACTATATTAT

Coding sequences of Glyma05g08400

Limit To All Plant Sequences

>Glyma05g08400.2   sequence type=CDS   gene model=Glyma05g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCAGAGAAATGTTACTGCTAATTCTTCTTTTGAAAGGACTAGCTTGCCTTCCCTAGATCAAAAGTTGGCCATGGCCAAGCGCTGCTCTCATGAGGGTGTGATGGCAGGAGCAAAAGCAGCTGTTGTTGCTACTATTGCTACTGCCATACCAACTCTGGCTAGTGTAAGGATGCTTCCTTGGGCAAGAGCCAATCTCAATCACTCTGCTCAAGCTCTCATAATTTCCACAGTGGCGGGAGCAGCATATTTCATAGTAGCTGACAAGACTGTCTTGGCAACTGCTAGAAAGAACTCCTTCAACCGACCCTCTAATGCATGA

>Glyma05g08400.3   sequence type=CDS   gene model=Glyma05g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCAGAGAAATGTTACTGCTAATTCTTCTTTTGAAAGGACTAGCTTGCCTTCCCTAGATCAAAAGTTGGCCATGGCCAAGCGCTGCTCTCATGAGGGTGTGATGGCAGGAGCCAAGGCAGCTGTTGTTGCTACTATTGCCACTGCCATTCCAACTCTCGCTAGTGTAAGGACAATACCTTGGGCAAGAGCCAATCTCAATCCCACTGCTCAAGCTCTCATAATTTCCACAGGTAATTACTTATCCACAGTGCTGTCATTATCTCCTCATAATCATTACAATCATTGTTCCAATTAG

Predicted protein sequences of Glyma05g08400

Limit To All Plant Sequences

>Glyma05g08400.2   sequence type=predicted peptide   gene model=Glyma05g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQRNVTANSSFERTSLPSLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRMLPWARANLNHSAQALIISTVAGAAYFIVADKTVLATARKNSFNRPSNA*

>Glyma05g08400.3   sequence type=predicted peptide   gene model=Glyma05g08400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQRNVTANSSFERTSLPSLDQKLAMAKRCSHEGVMAGAKAAVVATIATAIPTLASVRTIPWARANLNPTAQALIISTGNYLSTVLSLSPHNHYNHCSN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain