SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g08260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g08260): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g08260

Feature Type:gene_model
Chromosome:Gm05
Start:8219986
stop:8222377
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g08260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20010AT Annotation by Michelle Graham. TAIR10: RAS-related nuclear protein-1 | chr5:6760364-6761747 FORWARD LENGTH=221 SoyBaseE_val: 3.00E-151ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0096 KOG GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily JGI ISS
PTHR24071Panther FAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_C6TFN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TFN5_SOYBN SoyBaseE_val: 3.00E-165ISS
UniRef100_G1FK94UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ran n=1 Tax=Lepidium latifolium RepID=G1FK94_LEPLT SoyBaseE_val: 1.00E-148ISS

Expression Patterns of Glyma05g08260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g08260 not represented in the dataset
Glyma05g08260 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g08260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g010300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g08260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g08260
>Glyma05g08260.1   sequence type=CDS   gene model=Glyma05g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTGCCACAGCAACATACGGTTGACTATCCCAGTTTCAAGCTTGTCATCGTAGGCGACGGAGGAACTGGGAAAACCACTTTTGTCAAGAGACACATAACGGGAGAGTTTGAGAAGAAATATGAACCAACCATTGGTGTGGAGGTTCATCCACTAGACTTCCATACCAATTGTGGAAGAATTCGCTTTTACTGCTGGGACACTGCTGGCCAAGAAAAATTCGGTGGTCTTAGAGATGGTTATTATATTCATGGACACTGTGCTATCATTATGTTTGATGTAACAGCTCGCATGACATACAGGAACGTTGCTACATGGCACAGAGATCTCTGTCGGGTGTGTGAGAACATTCCCATTGTTCTCTGCGGAAACAAGGTTGATGTGAAGAATAGACAGGTTAAAGCAAAGCAGGTTACATTTCACAGGAAAAAGAATCTGCAGTACTATGAGATATCTGCAAAGAGTAACTACAATTTCGAAAAACCCTTTCTATACCTTGCCAAGAAACTTGCAGGGGATCAGGGCCTTCATTTTGTGGAAATGCCTGCTCTTGCTCCCCCGGACGTAGTCATTGATATAGCTACACAACAATTGAATGAAGAAGAGATATGTAGAGCGGCTGCTCAGCCTCTTCCTGATGACGAAGATGATTTATTTGAATAA
Predicted protein sequences of Glyma05g08260
>Glyma05g08260.1   sequence type=predicted peptide   gene model=Glyma05g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPQQHTVDYPSFKLVIVGDGGTGKTTFVKRHITGEFEKKYEPTIGVEVHPLDFHTNCGRIRFYCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTARMTYRNVATWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLAKKLAGDQGLHFVEMPALAPPDVVIDIATQQLNEEEICRAAAQPLPDDEDDLFE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo