Glyma05g08090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g08090

Feature Type:	gene_model
Chromosome:	Gm05
Start:	8020388
stop:	8027967
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g08090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19930	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function DUF92, transmembrane \| chr5:6737872-6739283 REVERSE LENGTH=288	SoyBase	E_val: 2.00E-46	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
PTHR13353	Panther	FAMILY NOT NAMED	JGI		ISS
PF01940	PFAM	Integral membrane protein DUF92	JGI		ISS
UniRef100_G7JU49	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7JU49_MEDTR	SoyBase	E_val: 4.00E-53	ISS
UniRef100_UPI000233A70A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A70A related cluster n=1 Tax=unknown RepID=UPI000233A70A	SoyBase	E_val: 3.00E-103	ISS

Expression Patterns of Glyma05g08090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g08090

Paralog	Evidence	Comments
Glyma17g12920	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g08090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g012000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g08090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g08090

Limit To All Plant Sequences

>Glyma05g08090.2   sequence type=CDS   gene model=Glyma05g08090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACTATTTCATTATGATGAGAAGCCTCGTCTAATCACAACCTTTAAGTTTGTGAAGAAAGGTACAAATGGTGGTGTGACAAAAAGAGGACTTCTAGCAGCTGCAGCAGCTGGAAGTGTCATTGGACTGTCATTTGTTCTTTTGGGAATCTCAGCTACCAGATGTGAGGGTAAGGGTAGTACAGTTCTTAAGCAACTACCGGTCATACCCGTGGCCACCCTTGCAGGACTGTGTGGAAGTGTCATTGACTCTCTCTTGGGTGCAACATTGCAATTCAGTGGATTTTGTTCCATTCGCGGCAAGATGGTTGGAAAGCCAGGATCAACAGTTAGAAGGATTTCAGGTGCCAACATTCTTGACAACAACGCAGTGAACTTCGTATCAATAATGTTGTATTCTCATTCATCAATTGGTAAAGTGGATTTCACCAACATTATAATAAAAACTGTATTTGGTTCTTGA

Predicted protein sequences of Glyma05g08090

Limit To All Plant Sequences

>Glyma05g08090.2   sequence type=predicted peptide   gene model=Glyma05g08090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLFHYDEKPRLITTFKFVKKGTNGGVTKRGLLAAAAAGSVIGLSFVLLGISATRCEGKGSTVLKQLPVIPVATLAGLCGSVIDSLLGATLQFSGFCSIRGKMVGKPGSTVRRISGANILDNNAVNFVSIMLYSHSSIGKVDFTNIIIKTVFGS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain