Glyma05g07900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g07900

Feature Type:	gene_model
Chromosome:	Gm05
Start:	7828263
stop:	7828619
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g07900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G73965	AT	Annotation by Michelle Graham. TAIR10: CLAVATA3/ESR-RELATED 13 \| chr1:27815822-27816145 FORWARD LENGTH=107	SoyBase	E_val: 1.00E-18	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0005102	GO-mf	Annotation by Michelle Graham. GO Molecular Function: receptor binding	SoyBase	N/A	ISS
UniRef100_E9L567	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CLE21 protein n=1 Tax=Glycine max RepID=E9L567_SOYBN	SoyBase	E_val: 1.00E-78	ISS
UniRef100_E9L567	UniRef	Annotation by Michelle Graham. Best UniRef hit: CLE21 protein n=1 Tax=Glycine max RepID=E9L567_SOYBN	SoyBase	E_val: 1.00E-78	ISS

Expression Patterns of Glyma05g07900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g07900

Paralog	Evidence	Comments
Glyma17g13100	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g07900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g013600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g07900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g07900

Limit To All Plant Sequences

>Glyma05g07900.1   sequence type=CDS   gene model=Glyma05g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGATCATCAGATTCCAACATCTACTAAGCTTCATTCTTTGGCTCTTCCTCTTCTTGGTACTCTTTCATGGCTGGTTTGGTTCCAAATCCAACAATGATAAGGCCATCATAAGCAACAACCAACTTCAGTTCTCTCTGTCTAGAAATAGAAGAATCTTAGCAGCTGGCCGAGGATTTGACTTCACCCCATTTCTCCGCCGCCACCGCCACCGCCACCGCCACCACCATCATCATCATCAGCATCACCACCACCGGAGTGGCGTGCCGGAGTCAAAGGAGACCGAGATTGATCCACGCTATGGTGTTGAGAAACGCCTTGTTCCAACTGGTCCAAACCCATTGCACCATTAA

Predicted protein sequences of Glyma05g07900

Limit To All Plant Sequences

>Glyma05g07900.1   sequence type=predicted peptide   gene model=Glyma05g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMIIRFQHLLSFILWLFLFLVLFHGWFGSKSNNDKAIISNNQLQFSLSRNRRILAAGRGFDFTPFLRRHRHRHRHHHHHHQHHHHRSGVPESKETEIDPRYGVEKRLVPTGPNPLHH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain