SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g07840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g07840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g07840

Feature Type:gene_model
Chromosome:Gm05
Start:7786847
stop:7789681
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g07840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18580AT Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein | chr3:6396940-6398068 REVERSE LENGTH=217 SoyBaseE_val: 1.00E-86ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
KOG1653 KOG Single-stranded DNA-binding protein JGI ISS
PTHR10302Panther SINGLE-STRANDED DNA-BINDING PROTEIN, SSB JGI ISS
PF00436PFAM Single-strand binding protein family JGI ISS
UniRef100_I1K195UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K195_SOYBN SoyBaseE_val: 5.00E-151ISS
UniRef100_Q9LII1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Single-stranded DNA-binding protein n=1 Tax=Arabidopsis thaliana RepID=Q9LII1_ARATH SoyBaseE_val: 7.00E-84ISS

Expression Patterns of Glyma05g07840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g07840 not represented in the dataset
Glyma05g07840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g07840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g014200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g07840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g07840
>Glyma05g07840.1   sequence type=CDS   gene model=Glyma05g07840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAGTTCCATGATGACGCTCTCAAGGAGGCTCTATTGCTCTCTGCTTCGAACCCCCAATGCATATCGCCACTTCTCCACCGATCACCTTTTCGACTCGGACGAGGCCGACTCAGCACCCGACCCACCCGCACCCGACGCCGTTCAAGAAGAAGAAAAGTTCGTCATCGATCGCCCCCTCGAGAATGGCCTCGACGTTGGCATCTACAGGGCTATTCTGGTAGGGAAGGCGGGGCAGGCTCCTTTGCAGAAGAAGCTTAAGAGTGGCACCTCCGTCACTCTTCTCTCCGTCGGCACCGGAGGGATTCACAACAACCGCAGGCCTCGCGTCGACGAGAACCCTAAGGACTATGCCAATCGCTCTGCCATTCAGTGGCATCGTGTCTCCGTTTATCCTCAGAAATTGGGAGACCTTGTCACCAAACACGTTGTTCCCGGTTCAATGCTGTACGTGGAGGGGAACCTCGAGACCAAATGCTTCACCGATCCGATAACCGGCATTGCCCGCCGAATTCGAGAAATTGCTGTTCGACGAAATGGTCGCATTGTATTTTTAGGTGAAGGCGGTGATGCTGAGCTGCAGACACTGCCAAAAGACCTGAGAGCTGTTGGCTATTACTAA
Predicted protein sequences of Glyma05g07840
>Glyma05g07840.1   sequence type=predicted peptide   gene model=Glyma05g07840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSMMTLSRRLYCSLLRTPNAYRHFSTDHLFDSDEADSAPDPPAPDAVQEEEKFVIDRPLENGLDVGIYRAILVGKAGQAPLQKKLKSGTSVTLLSVGTGGIHNNRRPRVDENPKDYANRSAIQWHRVSVYPQKLGDLVTKHVVPGSMLYVEGNLETKCFTDPITGIARRIREIAVRRNGRIVFLGEGGDAELQTLPKDLRAVGYY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo