SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g07630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g07630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g07630

Feature Type:gene_model
Chromosome:Gm05
Start:7648486
stop:7650174
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74010AT Annotation by Michelle Graham. TAIR10: Calcium-dependent phosphotriesterase superfamily protein | chr1:27832432-27834017 REVERSE LENGTH=325 SoyBaseE_val: 1.00E-72ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0016844GO-mf Annotation by Michelle Graham. GO Molecular Function: strictosidine synthase activity SoyBaseN/AISS
KOG1520 KOG Predicted alkaloid synthase/Surface mucin Hemomucin JGI ISS
PTHR10426Panther STRICTOSIDINE SYNTHASE-RELATED JGI ISS
PTHR10426:SF5Panther MUCIN-RELATED JGI ISS
PF03088PFAM Strictosidine synthase JGI ISS
UniRef100_G7JT37UniRef Annotation by Michelle Graham. Most informative UniRef hit: Strictosidine synthase n=1 Tax=Medicago truncatula RepID=G7JT37_MEDTR SoyBaseE_val: 2.00E-148ISS
UniRef100_I1K173UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K173_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g07630 not represented in the dataset

Glyma05g07630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g09110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g016500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g07630.1   sequence type=CDS   gene model=Glyma05g07630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCAAACATTGCAACAATGATAGCTATCTCTGCAATTTTTATGATTTTCTTCTTGTGTTCGCCATCAGTGGCTATATTAATCAGCAGGTTACCACTACCGTCACCGGTGACAGGCCCTGAGTCCGTAGCATTCGACCGGAACGGTGGAGGGCCATATGTTGGTGTTTCTGATGGAAGAATTCTCAAATATGCTGGTCCAGGCGAGGGTTTCAAGGAATATGCTTTCACTTCACCAAACAGGAACAAGACAATCTGTGATGGGCTTGCTGATTTCTCAGAACTCCAAGCAACATGTGGGAGGCCATTAGGATTACGTTTCAACCATCAAACAAACGAACTATACGTAGCGGATGCTTATTCTGGGCTTATCAAGATTGGACCCAATGGAGGGGCTCCAACCCAATGCTTTAAAGATATACAACCACAACAAGAGAATGTGAACACTACTCTTCAGTTTCTCGATGGCTTGGATGTAGACGTCAACACTGGAATCGTTTATTTCACCCAAGCTAGTGCTAACTACGGTTTCAAGGATGCTCAGGCACTACAAAGCAGTAGAGACCAATCTGGGAGCCTATTCTCACTGGATCCCAAAACGAACCAAACAAGAGTGTTGATGAGGGGTCTTGCATTGGCATCTGGGGTGGCAGTAAGCAGAGACGGGTCATTTGTGCTTGTTAGTGAATACTTGGCAAACAGAATTCAGAGATTTTGGCTAAGAGGGCCAAGAGCAAATTCTTCTGAACTATTCTTGCAACTCACTGGTAGACCAGACAACATTAGGAGCAACCAGAGAGGTCAATTTTGGGTGGCAGTGAATGGTGTTTTAGGACCAAATCCACCTCCTAGGCCCACTATTTTACCTGCTGGAGTCAGAATTAGTGAGAACGGTATCATTTTACGGATTGTTTCTCTTGTCCAGGAGTTTGGTAGTGAGGCAGTGAGTGAGATTCATGAGCATAACGGGACACTCTACTCTGGCTCCTTGCAAGCTTCCTATGTTCCCATTTCTGCTATGATCTAG

>Glyma05g07630.1   sequence type=predicted peptide   gene model=Glyma05g07630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSNIATMIAISAIFMIFFLCSPSVAILISRLPLPSPVTGPESVAFDRNGGGPYVGVSDGRILKYAGPGEGFKEYAFTSPNRNKTICDGLADFSELQATCGRPLGLRFNHQTNELYVADAYSGLIKIGPNGGAPTQCFKDIQPQQENVNTTLQFLDGLDVDVNTGIVYFTQASANYGFKDAQALQSSRDQSGSLFSLDPKTNQTRVLMRGLALASGVAVSRDGSFVLVSEYLANRIQRFWLRGPRANSSELFLQLTGRPDNIRSNQRGQFWVAVNGVLGPNPPPRPTILPAGVRISENGIILRIVSLVQEFGSEAVSEIHEHNGTLYSGSLQASYVPISAMI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo