SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g07470

Feature Type:gene_model
Chromosome:Gm05
Start:7528952
stop:7534647
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g07470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26300AT Annotation by Michelle Graham. TAIR10: BSD domain-containing protein | chr1:9096023-9099746 REVERSE LENGTH=316 SoyBaseE_val: 6.00E-63ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03909PFAM BSD domain JGI ISS
UniRef100_B4FWY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: BSD domain containing protein n=1 Tax=Zea mays RepID=B4FWY5_MAIZE SoyBaseE_val: 5.00E-69ISS
UniRef100_I1K159UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K159_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g07470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g07470
ParalogEvidenceComments
Glyma17g08961 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g07470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g018000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g07470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g07470
>Glyma05g07470.1   sequence type=CDS   gene model=Glyma05g07470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCTGTGGAACAGAGCCCGAAGCTTTGCGGAAGAAGCAGCGAAACGATCCCAGGAACTGTCGTTGGGAGCTAGAGCTACCCAATTCACCAACATCATAGCAGAAACCACCAAAGAAATCGCAGCGCAAGCTTCCAAGCACTTGCCCCGACCTTATGCCATAAACGACGTCGATCTCCACCGTTTTGGCATCACCGAAGAGTTGAGGGACTTTGTCAAAGGAATCACCATCACTACCTTTGAGGATTTTCCCCTTCAAGATGATACGGAATTGTCTGATGTTCCTGCAGTTTCAAATGTTAGGCAGGACCTAACCGAGTGGCAGGAAAAACATGCCAGTCTTGTTCTTTCTACAGTCAAGGAGATTTCAGGATTGAGGTATGAACTGTGTCCACGAGTCATGAAAGAGAGGAAGTTTTGGAGAATATATTTTATACTTGTGAATAATCACACTGCACCCTATGAGAATAAGTACATGGAAGACAATAAACTAAAATCATGTGAACAAGTAAAAGATCACAAAGTGATGATGGAATCCTTAAACACTGAATTGATCTCCAATCAAGAGGTGCAAGAAGTGAAAAAGGAGGCCAAACCTTCGAATTCATCAACAGAGCAAGACTTGGATGTATTTCTTCTGGGAGAAGGAAACAGTGATGATGAGCCTGATGATGGCGATGGGGGATATGATGATGATTTGGAAAAACTGATGGATAATTCGGATGATGAGAAAGGGAAATCATAG
Predicted protein sequences of Glyma05g07470
>Glyma05g07470.1   sequence type=predicted peptide   gene model=Glyma05g07470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELWNRARSFAEEAAKRSQELSLGARATQFTNIIAETTKEIAAQASKHLPRPYAINDVDLHRFGITEELRDFVKGITITTFEDFPLQDDTELSDVPAVSNVRQDLTEWQEKHASLVLSTVKEISGLRYELCPRVMKERKFWRIYFILVNNHTAPYENKYMEDNKLKSCEQVKDHKVMMESLNTELISNQEVQEVKKEAKPSNSSTEQDLDVFLLGEGNSDDEPDDGDGGYDDDLEKLMDNSDDEKGKS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo