Glyma05g06780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g06780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g06780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g06780

Feature Type:	gene_model
Chromosome:	Gm05
Start:	6846917
stop:	6851827
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g06780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G21720	AT	Annotation by Michelle Graham. TAIR10: isocitrate lyase \| chr3:7652789-7655873 REVERSE LENGTH=576	SoyBase	E_val: 1.00E-62	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0019752	GO-bp	Annotation by Michelle Graham. GO Biological Process: carboxylic acid metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004451	GO-mf	Annotation by Michelle Graham. GO Molecular Function: isocitrate lyase activity	SoyBase	N/A	ISS
PTHR21631	Panther	ISOCITRATE LYASE/MALATE SYNTHASE	JGI		ISS
PTHR21631:SF3	Panther	ISOCITRATE LYASE	JGI		ISS
PF00463	PFAM	Isocitrate lyase family	JGI		ISS
UniRef100_I1LRS0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Isocitrate lyase n=1 Tax=Glycine max RepID=I1LRS0_SOYBN	SoyBase	E_val: 2.00E-65	ISS
UniRef100_UPI000233A598	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A598 related cluster n=1 Tax=unknown RepID=UPI000233A598	SoyBase	E_val: 3.00E-83	ISS

Expression Patterns of Glyma05g06780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g06780 not represented in the dataset	Glyma05g06780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g06780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g074000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g06780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g06780

Limit To All Plant Sequences

>Glyma05g06780.1   sequence type=CDS   gene model=Glyma05g06780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAGAAGCGAGGGTCAAAGTCGAAGTGGCAGAGGTGCAAGCATGGTGGAACTCTGAGAGACAAACCTATGCCTCGAACGAGATGGCGAAAAAGCTATGGCACCTCCTGAAGAACCACCAAGCGAATGGAATAGCCTCAAGGACTTTTGGTGCACTTGATCCTGTTCAGGTCACCCAAATGGCCAAGCACTTGGATACAATCTATGTCTCAGGGTGGCAATATTCAGCCACACACACCACGAGCAACAAGCCCGGTCCTGACCTTGCTGATTACCCTTATGACACTGTCCCAAACAAGGTTGGGCATCTCTTCTTTGCTCAGCAGTGCCATGACAGGAAGCAAAAAGAGGATCGCTCAATGAAGTAG

Predicted protein sequences of Glyma05g06780

Limit To All Plant Sequences

>Glyma05g06780.1   sequence type=predicted peptide   gene model=Glyma05g06780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEEARVKVEVAEVQAWWNSERQTYASNEMAKKLWHLLKNHQANGIASRTFGALDPVQVTQMAKHLDTIYVSGWQYSATHTTSNKPGPDLADYPYDTVPNKVGHLFFAQQCHDRKQKEDRSMK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain