Glyma05g05990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g05990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g05990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g05990

Feature Type:	gene_model
Chromosome:	Gm05
Start:	5520418
stop:	5521084
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g05990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G12110	AT	Annotation by Michelle Graham. TAIR10: sterol-4alpha-methyl oxidase 1-1 \| chr4:7254197-7256004 FORWARD LENGTH=298	SoyBase	E_val: 1.00E-102	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0046520	GO-bp	Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0080064	GO-bp	Annotation by Michelle Graham. GO Molecular Function: 4,4-dimethyl-9beta,19-cyclopropylsterol-4alpha-methyl oxidase activity	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000254	GO-mf	Annotation by Michelle Graham. GO Molecular Function: C-4 methylsterol oxidase activity	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
KOG0873	KOG	C-4 sterol methyl oxidase	JGI		ISS
PTHR11863	Panther	STEROL DESATURASE	JGI		ISS
PTHR11863:SF21	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF04116	PFAM	Fatty acid hydroxylase superfamily	JGI		ISS
UniRef100_G7JK82	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sterol-4-methyl-oxidase n=1 Tax=Medicago truncatula RepID=G7JK82_MEDTR	SoyBase	E_val: 2.00E-108	ISS
UniRef100_I1K103	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K103_SOYBN	SoyBase	E_val: 1.00E-137	ISS

Expression Patterns of Glyma05g05990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g05990 not represented in the dataset	Glyma05g05990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g05990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g069500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g05990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g05990

Limit To All Plant Sequences

>Glyma05g05990.1   sequence type=CDS   gene model=Glyma05g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCCCTACGCTTCCATCCCAGAGGCCGCGGCGGCGCTAGGCCGCAACCTCACCTTCGCGGAGACCCTCTGGTTCAACTACTCCGCCGCCAAGTCCAATTACTTCCTCTACTGCCACAACATTTTGTTCCTCTTCCTCTTCCTCGTCTTTTCCCTTGTCCCCCTCCCCCTCGTCTTCCTCGAATTCAAGCGCTTCTCCTTCGTCTCTTCCCACAAGATCCAACCAAAAGTCCACTTGTCCCTCACCGAAACCTTCAAGTGCTACAAAGACATCATGCACATGTTCTTCCTCGTCGTCGGCCCCTTCCAACTCATCTCTTACCCTTCCATCCAATACGTTCCCCTCACCGTCACCATCACCGTGCTCATCGAGGGAAGAGATTTATTTATTGATTTATTAATCACTATCTTTTTTCTCGTAGAGGATTACACCAATTACTGGATCCATAGGTTTCTGCACAACGATTGGGGGTACGAGAAGATTCACCGCGTCCACCATGAGTACCATGCACCCATTGGATTCGTCGCGCCCTATGCTCACTGGGTTGAGATCTTGATCCTCGGGATTCCCTCCTTTCTTGGACCTGCCATGGTTCCTGGCCACATGATCACCTTTTGGCTCTGGAAAGCCTTGCGCCAGATTGAAGCCATTAACACACACAGC

Predicted protein sequences of Glyma05g05990

Limit To All Plant Sequences

>Glyma05g05990.1   sequence type=predicted peptide   gene model=Glyma05g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPYASIPEAAAALGRNLTFAETLWFNYSAAKSNYFLYCHNILFLFLFLVFSLVPLPLVFLEFKRFSFVSSHKIQPKVHLSLTETFKCYKDIMHMFFLVVGPFQLISYPSIQYVPLTVTITVLIEGRDLFIDLLITIFFLVEDYTNYWIHRFLHNDWGYEKIHRVHHEYHAPIGFVAPYAHWVEILILGIPSFLGPAMVPGHMITFWLWKALRQIEAINTHS

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain