|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G11830 | AT | Annotation by Michelle Graham. TAIR10: TCP-1/cpn60 chaperonin family protein | chr3:3732734-3736156 FORWARD LENGTH=555 | SoyBase | E_val: 3.00E-36 | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0042545 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall modification | SoyBase | N/A | ISS |
| GO:0044267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
| PTHR11353 | Panther | CHAPERONIN | JGI | ISS | |
| PF00118 | PFAM | TCP-1/cpn60 chaperonin family | JGI | ISS | |
| UniRef100_G7K2W1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit eta n=1 Tax=Medicago truncatula RepID=G7K2W1_MEDTR | SoyBase | E_val: 5.00E-35 | ISS |
| UniRef100_I1K101 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K101_SOYBN | SoyBase | E_val: 1.00E-73 | ISS |
|
Glyma05g05940 not represented in the dataset |
Glyma05g05940 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g069300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g05940.1 sequence type=CDS gene model=Glyma05g05940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGAATGATACATAGGAAGCCACAGCTGTTGAGCAACATCAATGCCTGCACTGCCGTCGTTGACATCGTTCGCACCACCCTCGACCCTCGCGGCATGGACAAGCTCATCCACGATGACAAGGGAGCCGTCACCATCTCCAACGACGACGCCACCATCATGAAGCTCCTCGACATCGTCCACCCCGCTGCAAAAATCCTCGCCGACATCGCCAAGTCTCAGGACTCTGAGGTAACTTTAACTTCCCTTCGATCTCATGCAATGCCACTGCTTTCAAGATCTGTTCATTTTCGCTTCATTCAGATGCTTTACACTGTGGAATTGGAATTTTAA
>Glyma05g05940.1 sequence type=predicted peptide gene model=Glyma05g05940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGMIHRKPQLLSNINACTAVVDIVRTTLDPRGMDKLIHDDKGAVTISNDDATIMKLLDIVHPAAKILADIAKSQDSEVTLTSLRSHAMPLLSRSVHFRFIQMLYTVELEF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||