SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g05860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g05860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g05860

Feature Type:gene_model
Chromosome:Gm05
Start:5406029
stop:5411516
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44610AT Annotation by Michelle Graham. TAIR10: Ras-related small GTP-binding family protein | chr2:18411778-18413883 REVERSE LENGTH=208 SoyBaseE_val: 1.00E-139ISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0032940GO-bp Annotation by Michelle Graham. GO Biological Process: secretion by cell SoyBaseN/AISS
GO:0000139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0094 KOG GTPase Rab6/YPT6/Ryh1, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF256Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_I3SA75UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Medicago truncatula RepID=I3SA75_MEDTR SoyBaseE_val: 3.00E-147ISS
UniRef100_Q40525UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nt-rab6 protein n=1 Tax=Nicotiana tabacum RepID=Q40525_TOBAC SoyBaseE_val: 2.00E-134ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g05860 not represented in the dataset

Glyma05g05860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g16200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g068900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g05860.1   sequence type=CDS   gene model=Glyma05g05860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCCAGTGTCGGCTCTCGCAAAGTACAAGCTGGTGTTCTTGGGTGATCAGTCCGTTGGGAAAACCAGCATCATCACTCGCTTCATGTACGACAAATTCGACAACACTTATCAGGCTACAATCGGTATCGATTTTCTGTCAAAAACTATGTATCTTGAAGATCGAACTGTTCGACTGCAGTTGTGGGATACAGCTGGACAGGAAAGATTTAGAAGTCTTATTCCAAGCTACATTAGGGACTCATCTGTTGCTGTCATTGTTTATGATGTTGCAAGCCGTCAGACTTTCCTAAACACATCAAAGTGGATTGAAGAGGTGCGCAGTGAAAGAGGCAGCGATGTTATTGTGGTTCTTGTTGGGAACAAAACTGATCTTGTGGATAAAAGGCAAGTCTCTACAGAGGAAGGGGAAGCAAAGTCCCGAGAGCTAAACGTTATGTTTATTGAGGCTAGTGCAAAAGCCGGCTTTAATATAAAGGCCCTCTTTCGAAAAATTGCTGCTGCATTACCCGGAATGGAAACACTATCTACAACAAAACAGGAAGATATGGTCGACGTGAACCTGAGGTCTTCTGGTAGCCATGATTCCCAACCTCAGTCAGGGGGATGTTCTTGCTGA

>Glyma05g05860.1   sequence type=predicted peptide   gene model=Glyma05g05860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLVGNKTDLVDKRQVSTEEGEAKSRELNVMFIEASAKAGFNIKALFRKIAAALPGMETLSTTKQEDMVDVNLRSSGSHDSQPQSGGCSC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo