Glyma05g05693 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g05693): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g05693): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g05693

Feature Type:	gene_model
Chromosome:	Gm05
Start:	5117884
stop:	5118508
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g05693

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12110	AT	Annotation by Michelle Graham. TAIR10: actin-11 \| chr3:3858116-3859609 FORWARD LENGTH=377	SoyBase	E_val: 2.00E-49	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0030036	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005856	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0005200	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PTHR11937	Panther	ACTIN	JGI		ISS
PTHR11937:SF77	Panther	ACTIN	JGI		ISS
PF00022	PFAM	Actin	JGI		ISS
UniRef100_D5LN06	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Actin (Fragment) n=1 Tax=Vicia sativa RepID=D5LN06_VICSA	SoyBase	E_val: 4.00E-50	ISS
UniRef100_UPI000233A413	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A413 related cluster n=1 Tax=unknown RepID=UPI000233A413	SoyBase	E_val: 2.00E-73	ISS

Expression Patterns of Glyma05g05693

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g05693 not represented in the dataset	Glyma05g05693 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g05693 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g067600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g05693

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g05693

Limit To All Plant Sequences

>Glyma05g05693.1   sequence type=CDS   gene model=Glyma05g05693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCCAAATTATGTTTGAGACTTTCAATGTGCCTATCATATATGTTGCAATTCAGGTTGTCTTGTCTCTTTTTGTGCTTGATTTTGGTGATGGTGTGAGCCACACGGTTCCAATATATGAAGGGTATGTTCTTCCTCGTGCAATTCTTCGGTTGGACCTTGCTGGCCGTGATTTAACAGAGTACTTGGTGAAAATCCTTACTGAGAGAGGATACTCCTTTAGCACCTCTGCCGAAAAGGAAATTGTTCGTGATATGAAGGAGAAATTGGCATATGTGGCCTATGAAGCACCGACACCGACACGGACATCGGACACGACACGGACACAGACACGTGGACACCTGTAA

Predicted protein sequences of Glyma05g05693

Limit To All Plant Sequences

>Glyma05g05693.1   sequence type=predicted peptide   gene model=Glyma05g05693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTQIMFETFNVPIIYVAIQVVLSLFVLDFGDGVSHTVPIYEGYVLPRAILRLDLAGRDLTEYLVKILTERGYSFSTSAEKEIVRDMKEKLAYVAYEAPTPTRTSDTTRTQTRGHL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain