SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g05380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g05380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g05380

Feature Type:gene_model
Chromosome:Gm05
Start:4687614
stop:4689199
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g05380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17030AT Annotation by Michelle Graham. TAIR10: expansin-like B1 | chr4:9581817-9583181 REVERSE LENGTH=250 SoyBaseE_val: 2.00E-36ISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009828GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening SoyBaseN/AISS
GO:0019953GO-bp Annotation by Michelle Graham. GO Biological Process: sexual reproduction SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF03330PFAM Rare lipoprotein A (RlpA)-like double-psi beta-barrel JGI ISS
UniRef100_I1K0V5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K0V5_SOYBN SoyBaseE_val: 2.00E-127ISS
UniRef100_O23547UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expansin-like B1 n=2 Tax=Arabidopsis thaliana RepID=EXLB1_ARATH SoyBaseE_val: 9.00E-34ISS

Expression Patterns of Glyma05g05380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g05380 not represented in the dataset
Glyma05g05380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g05380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g065200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g05380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g05380
>Glyma05g05380.2   sequence type=CDS   gene model=Glyma05g05380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTCAGTTTTAAGCACCAACTTGGGCTAGTTTGTGTCATATTGTTCTTCCCTGCACTGTGTAACTGTCAGGAATATATTGGCCCTGTTGATGATTACTGGAATCCAATTGGAGCTTGTGGGTTCGGCGAATATGGAAAGACGGTGAATAATGGCATTGTCGCAGCAGTGTCTGAGCCGCTATGGAGGGATGGAGCTGGCTGTGGTACATGCTATCAGGTATGCTGCAAACTGCAATGCTGCGATGAGAAGGGAGTATACGTGGTAGTAAGTGATGCACAGGGAGACAGAAGAAACTCCAGCTTGACCTTGAGCCCTGGAGCCTTGTCAATATTAGTACACAACAAACCTGGATGTGCAAATCGGATCAAACATGACATGGGCGATATTGTAATCAAAAGGGTGCCCTGTAGATACCCTGGCAACATCAAGCTCCGTGTCCAGGAGAGCAGCAAAAACCCAGGCTACTTTGCAGTTGTCATTCTCGACGTAAATGGAATACGCGACATCACTGCAGTTGAGATGTGGCTGCATATTATCATCTAA
Predicted protein sequences of Glyma05g05380
>Glyma05g05380.2   sequence type=predicted peptide   gene model=Glyma05g05380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELSFKHQLGLVCVILFFPALCNCQEYIGPVDDYWNPIGACGFGEYGKTVNNGIVAAVSEPLWRDGAGCGTCYQVCCKLQCCDEKGVYVVVSDAQGDRRNSSLTLSPGALSILVHNKPGCANRIKHDMGDIVIKRVPCRYPGNIKLRVQESSKNPGYFAVVILDVNGIRDITAVEMWLHIII*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo