SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g05281): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g05281): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g05281

Feature Type:gene_model
Chromosome:Gm05
Start:4607292
stop:4621409
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47180AT Annotation by Michelle Graham. TAIR10: Plant VAMP (vesicle-associated membrane protein) family protein | chr5:19161384-19163265 REVERSE LENGTH=220 SoyBaseE_val: 3.00E-91ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
KOG0439 KOG VAMP-associated protein involved in inositol metabolism JGI ISS
PTHR10809Panther VESICLE-ASSOCIATED MEMBRANE PROTEIN (VAMP) JGI ISS
PTHR10809:SF6Panther VESICLE-ASSOCIATED MEMBRANE PROTEIN-ASSOCIATED PRO JGI ISS
PF00635PFAM MSP (Major sperm protein) domain JGI ISS
UniRef100_G7JYK1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein n=1 Tax=Medicago truncatula RepID=G7JYK1_MEDTR SoyBaseE_val: 6.00E-102ISS
UniRef100_UPI00023399ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023399AD related cluster n=1 Tax=unknown RepID=UPI00023399AD SoyBaseE_val: 2.00E-147ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g05281 not represented in the dataset

Glyma05g05281 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g15590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g064600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g05281.1   sequence type=CDS   gene model=Glyma05g05281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCATAATGTTTATGTCAACAGTTGAGCTGGAGAAGCAAACATACTGTGATCTTAAAGTTCTGAATAACACAGGGAACTACGTTGCCTTTAAGGTCAAAACCACTTCGCCAAAGAAGTACTTTGTGCGACCTAATACCGGTGTTGTACATCCATGGGACTCATGTATCATCAGAGTCACCCTCCAGGCTCAACAAGAATACCCTCCAGACATGCAATGCAAAGACAAGTTTCTCTTGCAGAGTACAATAGTGAATCCAAACACTGATGTTGATGATCTTCCACCAGATACTTTTAATAAGGATGGTGAAAAGTCGATAGAGGATATGAAACTAAGAGTGGTATATATCTCTCCTACATCACCCCAAGGAAGCACAGAAGGTGACACAGTGAAGAATTCAACCCAAAAACCTGATACTAATTCTAGTGAAACCGTGCAGCGCCTGAAGGAGGAAAGAGATGCCAATGTCTTACAAACACGGCAACTGCAGCAGGAACTGGACATGCTGAAAAGAAGAAGAAATCGTAGAGGGGATCCAGGCTTTTCCTTCACTTTTGCCATGTTTGTGGGTCTCATTGGATTATTGTGTGGTTTGCTTTTAAAACTTTCATTGTCTTCACCACCTACAGAATGA

>Glyma05g05281.1   sequence type=predicted peptide   gene model=Glyma05g05281   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIMFMSTVELEKQTYCDLKVLNNTGNYVAFKVKTTSPKKYFVRPNTGVVHPWDSCIIRVTLQAQQEYPPDMQCKDKFLLQSTIVNPNTDVDDLPPDTFNKDGEKSIEDMKLRVVYISPTSPQGSTEGDTVKNSTQKPDTNSSETVQRLKEERDANVLQTRQLQQELDMLKRRRNRRGDPGFSFTFAMFVGLIGLLCGLLLKLSLSSPPTE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo