SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g05180

Feature Type:gene_model
Chromosome:Gm05
Start:4460844
stop:4462512
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g05180
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17500AT Annotation by Michelle Graham. TAIR10: ethylene responsive element binding factor 1 | chr4:9759405-9760211 FORWARD LENGTH=268 SoyBaseE_val: 5.00E-81ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005643GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear pore SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G8EVZ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene response factor 11 n=1 Tax=Medicago sativa RepID=G8EVZ8_MEDSA SoyBaseE_val: 2.00E-111ISS
UniRef100_I1K0U3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K0U3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g05180
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g05180
ParalogEvidenceComments
Glyma17g15480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g05180 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g063600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g05180
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g05180
>Glyma05g05180.1   sequence type=CDS   gene model=Glyma05g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACGGACAGAGTAGTAGTAGCAGTAGTTCTTACGAATCGGATTTGGCGCTGTTGGATTCGATTCGGCACCACTTGCTGGGCGAGTCCGAATCCATATTCGGCGCCCCGAATTTCGGGTCGGGTCGGAGCTCCAGTTTCAGCAGCTTGGACTCGTGTTTGAGCGACAATTGGGGCGAGCTTCCGTTTAAGGAGGACGATACAGAAGACATGGTGTTGTACGGCGTTCTCCGTGACGCCGTTAACGTCGGGTGGGTCCCATCTCTCGATGCCGGGTCGCCCGAGAGCGTGTCGTCGGGTTTTCCGGCGGTGAAGCTGGAGCCGGACTTGATGCCGGCGCTGATAAGTCCGTGTCCGCCTCCGGCGGCTGCGGCGGAGGAGAAGAAGGTTGTTCCGGCGAAGGGGAAGCACTACCGCGGCGTGCGGCAGCGGCCGTGGGGGAAGTTCGCGGCGGAGATCCGCGACCCGGCGAAGAACGGAGCAAGGGTTTGGCTGGGGACGTTTGAGACGGCGGAGGACGCGGCGTTGGCGTACGACCGCGCCGCCTACCGGATGAGGGGGTCGAGGGCGTTGCTGAATTTTCCGTTGAGGGTTAACTCCGGCGAGCCCGATCCGGTGAGGGTGAAGTCGAAGCGGTCGTCGTCGCCAGAGAGTGCGGCGGCGCTGCCGGCGAAGAGAAAGAAAGTTGTGGTGGTGGGGACGGTGCAAGAGCAAGTGGGGAGTCAAGTGGCAGAGTGTACACGTGGCGAGCAGTTATTGGTTAGCTGA
Predicted protein sequences of Glyma05g05180
>Glyma05g05180.1   sequence type=predicted peptide   gene model=Glyma05g05180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYGQSSSSSSSYESDLALLDSIRHHLLGESESIFGAPNFGSGRSSSFSSLDSCLSDNWGELPFKEDDTEDMVLYGVLRDAVNVGWVPSLDAGSPESVSSGFPAVKLEPDLMPALISPCPPPAAAAEEKKVVPAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPVRVKSKRSSSPESAAALPAKRKKVVVVGTVQEQVGSQVAECTRGEQLLVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo