SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g04020

Feature Type:gene_model
Chromosome:Gm05
Start:3137443
stop:3142614
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g04020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12410AT Annotation by Michelle Graham. TAIR10: CLP protease proteolytic subunit 2 | chr1:4223099-4224954 FORWARD LENGTH=279 SoyBaseE_val: 2.00E-145ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplastic endopeptidase Clp complex SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
KOG0840 KOG ATP-dependent Clp protease, proteolytic subunit JGI ISS
PTHR10381Panther PROTEASE FAMILY S14 CLPP PROTEASE JGI ISS
PF00574PFAM Clp protease JGI ISS
UniRef100_I1K0I6UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=I1K0I6_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1K0I6UniRef Annotation by Michelle Graham. Best UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=I1K0I6_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g04020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g04020
ParalogEvidenceComments
Glyma17g14510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g04020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g053600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g04020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g04020
>Glyma05g04020.1   sequence type=CDS   gene model=Glyma05g04020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCATTTCTCTTGCAACAAGTAACTCGTTCAGATTTTGGTTTTTGCTTCCCTATCCGCTCTCTCTTCTTCACTTCAGTATGGCGGTGGTACCTTACACCACCGGTTCTGCACCTCTTCTTTCTCCTCCTTCTACTTCTAGTGTTGCCACAAAGCTCTACTCCGGATTGAAACTTCAAGCTGCGAGTCCTTTCGGAGCTGCAAAACCTAACGTAACCGCTGAGTTTTATGGAAAAGTTCACAACACTCTTCACTGTCGGTATGCTAACCACAATACATCAATGGCACGTATTCGAATGATGCCAATAGGGACTCCTAAAGTCCCCTATAGGACACCTGGTGAAGGAACTTGGCAATGGGTTGATGTATGGAACGCCCTTTATCGAGAACGTGTTATCTTCATTGGACAAGAGATAGATGAAGAATTTAGTAACCAAATATTGGCTACTATGCTTTATCTTGACAGTATAGAAAACTCCAAGAAGCTTTATATGTACATCAATGGCCCTGGTGGTGATCTTACACCAAGCATGGCTATCTATGACACCATGCAGAGCTTGCAAAGTCCTGTAGCCACCCACTGTGTTGGCTATGCTTATAGTCTTGCAGCATTTCTCCTTGCAGCTGGAGAAAAGGGTAATCGTTCTGCAATGCCTCTATCAAGAGTTGCCCTTACATCACCAGCTGGAGCCGCCCGTGGACAGGCTGATGACATTCAGAATGAAGCAAATGAACTTCTTAGAATCAGAGATTACCTTTTCAATGAGTTGGCACAGAAAACGGGTCAACCTGTTGAGAAGATTACTAAAGACTTGAGTAGGATGAAACGCTTCAACGCACAGGAAGCCCTTGAATATGGACTCATTGATCGAATTGTCAGGCCACCCCGCATTAAGGCTGATGCACCACGCAAGGAAGCAGGCACAGGTCTTGGTTAA
Predicted protein sequences of Glyma05g04020
>Glyma05g04020.1   sequence type=predicted peptide   gene model=Glyma05g04020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFISLATSNSFRFWFLLPYPLSLLHFSMAVVPYTTGSAPLLSPPSTSSVATKLYSGLKLQAASPFGAAKPNVTAEFYGKVHNTLHCRYANHNTSMARIRMMPIGTPKVPYRTPGEGTWQWVDVWNALYRERVIFIGQEIDEEFSNQILATMLYLDSIENSKKLYMYINGPGGDLTPSMAIYDTMQSLQSPVATHCVGYAYSLAAFLLAAGEKGNRSAMPLSRVALTSPAGAARGQADDIQNEANELLRIRDYLFNELAQKTGQPVEKITKDLSRMKRFNAQEALEYGLIDRIVRPPRIKADAPRKEAGTGLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo