Glyma05g03880 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g03880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g03880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g03880

Feature Type:	gene_model
Chromosome:	Gm05
Start:	2989175
stop:	2991352
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g03880

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00100	AT	Annotation by Michelle Graham. TAIR10: ribosomal protein S13A \| chr4:37172-38123 FORWARD LENGTH=151	SoyBase	E_val: 2.00E-100	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010090	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis	SoyBase	N/A	ISS
GO:0042545	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall modification	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0400	KOG	40S ribosomal protein S13	JGI		ISS
PTHR11885	Panther	RIBOSOMAL PROTEIN S15P/S13E	JGI		ISS
PF00312	PFAM	Ribosomal protein S15	JGI		ISS
PF08069	PFAM	Ribosomal S13/S15 N-terminal domain	JGI		ISS
UniRef100_P62302	UniRef	Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S13 n=3 Tax=Glycine max RepID=RS13_SOYBN	SoyBase	E_val: 9.00E-105	ISS
UniRef100_P62302	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S13 n=3 Tax=Glycine max RepID=RS13_SOYBN	SoyBase	E_val: 9.00E-105	ISS

Expression Patterns of Glyma05g03880

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g03880 not represented in the dataset	Glyma05g03880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g03880 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g052400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g03880

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma05g03880

Limit To All Plant Sequences

>Glyma05g03880.2   sequence type=transcript   gene model=Glyma05g03880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGTATGCACAGCCGCGGTAAGGGTATATCCTCTTCTGCTTTGCCCTACAAAAGGACACCTCCTAGCTGGCTCAAGATCTCTTCGCAAGATGTCGAAGAAAATATCTGCAAGTTTGCGAAGAAAGGTTTGACCCCGTCTCAGATTGGTGTCATTCTCAGAGATTCTCACGGTATTGCTCAGGTCAATAGCGTCACTGGCAGCAAAATCCTTCGCATCCTCAAAGCTCACGGACTTGCGCCTGAAATTCCAGAGGATCTGTACCATTTGATTAAGAAGGCAGTTTCAATTAGGAAGCATCTTGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCAGGTTGATTCTTGTTGAGAGCAGAATCCACCGACTTGCTCGCTATTACAAGAAGACTAAGAAGCTCCCACCAGTCTGGAAGTAG

Coding sequences of Glyma05g03880

Limit To All Plant Sequences

>Glyma05g03880.1   sequence type=CDS   gene model=Glyma05g03880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGTATGCACAGCCGCGGTAAGGGTATATCCTCTTCTGCTTTGCCCTACAAAAGGACACCTCCTAGCTGGCTCAAGATCTCTTCGCAAGATGTCGAAGAAAATATCTGCAAGTTTGCGAAGAAAGGTTTGACCCCGTCTCAGATTGGTGTCATTCTCAGAGATTCTCACGGTATTGCTCAGGTCAATAGCGTCACTGGCAGCAAAATCCTTCGCATCCTCAAAGCTCACGGACTTGCGCCTGAAATTCCAGAGGATCTGTACCATTTGATTAAGAAGGCAGTTTCAATTAGGAAGCATCTTGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCAGGTTGATTCTTGTTGAGAGCAGAATCCACCGACTTGCTCGCTATTACAAGAAGACTAAGAAGCTCCCACCAGTCTGGAAGTACGAATCAACAACTGCTAGCACTCTGGTTGCTTAG

>Glyma05g03880.2   sequence type=CDS   gene model=Glyma05g03880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGTATGCACAGCCGCGGTAAGGGTATATCCTCTTCTGCTTTGCCCTACAAAAGGACACCTCCTAGCTGGCTCAAGATCTCTTCGCAAGATGTCGAAGAAAATATCTGCAAGTTTGCGAAGAAAGGTTTGACCCCGTCTCAGATTGGTGTCATTCTCAGAGATTCTCACGGTATTGCTCAGGTCAATAGCGTCACTGGCAGCAAAATCCTTCGCATCCTCAAAGCTCACGGACTTGCGCCTGAAATTCCAGAGGATCTGTACCATTTGATTAAGAAGGCAGTTTCAATTAGGAAGCATCTTGAGAGGAACAGGAAGGACAAGGACTCCAAGTTCAGGTTGATTCTTGTTGAGAGCAGAATCCACCGACTTGCTCGCTATTACAAGAAGACTAAGAAGCTCCCACCAGTCTGGAAGTAG

Predicted protein sequences of Glyma05g03880

Limit To All Plant Sequences

>Glyma05g03880.1   sequence type=predicted peptide   gene model=Glyma05g03880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA*

>Glyma05g03880.2   sequence type=predicted peptide   gene model=Glyma05g03880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain