Report for Sequence Feature Glyma05g03030
Feature Type: gene_model
Chromosome: Gm05
Start: 2307668
stop: 2313334
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g03030
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G50335 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:20489391-20489615 REVERSE LENGTH=74
SoyBase E_val: 3.00E-15 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1K083 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K083_SOYBN
SoyBase E_val: 3.00E-41 ISS
Expression Patterns of Glyma05g03030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g03030
Paralog Evidence Comments
Glyma17g13690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g03030 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g045400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g03030
Coding sequences of Glyma05g03030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g03030.1 sequence type=CDS gene model=Glyma05g03030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGTCTAAAGTGGAAGAAGCAATGAAGAGGAACAAGCAAATGCAACCACAAGCCCAGAATCAGCAACAACAGCTGCAGAAACAAATTCAGTGCAACAAAGGAAAAGCTGGCAAGTTCAAGAGGAGCAGCTCCAATCTGGAAGAGGATGGTGCCTCTTCTGCCATTCTCTTTCTAGCTTGCATAGCTTATGCCCCTTCCTATGCGTAG
Predicted protein sequences of Glyma05g03030
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g03030.1 sequence type=predicted peptide gene model=Glyma05g03030 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVSKVEEAMKRNKQMQPQAQNQQQQLQKQIQCNKGKAGKFKRSSSNLEEDGASSAILFLACIAYAPSYA*