Glyma05g02863 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g02863): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g02863): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g02863

Feature Type:	gene_model
Chromosome:	Gm05
Start:	2185791
stop:	2188897
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g02863

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48360	AT	Annotation by Michelle Graham. TAIR10: BTB and TAZ domain protein 2 \| chr3:17908482-17910471 REVERSE LENGTH=364	SoyBase	E_val: 2.00E-90	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009734	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009743	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0010182	GO-bp	Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0051973	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of telomerase activity	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0003712	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transcription cofactor activity	SoyBase	N/A	ISS
GO:0004402	GO-mf	Annotation by Michelle Graham. GO Molecular Function: histone acetyltransferase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR24413	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24413:SF192	Panther		JGI		ISS
PF00651	PFAM	BTB/POZ domain	JGI		ISS
UniRef100_G7JMM8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Speckle-type POZ protein n=1 Tax=Medicago truncatula RepID=G7JMM8_MEDTR	SoyBase	E_val: 1.00E-118	ISS
UniRef100_UPI0002339F9A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339F9A related cluster n=1 Tax=unknown RepID=UPI0002339F9A	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma05g02863

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g02863 not represented in the dataset	Glyma05g02863 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g02863

Paralog	Evidence	Comments
Glyma17g13540	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g02863 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g043900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g02863

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g02863

Limit To All Plant Sequences

>Glyma05g02863.1   sequence type=CDS   gene model=Glyma05g02863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCCCAAACCATTTCCATTCACTACCACACCACCCGCTTCTTACCTCAACCCGATGTCTTCATTCGCACTTCCCACGGAACACGCATTCCAGCCCACGCCGGCATTCTGGCTTCCATGTCCCCTGTTTTTGACAACTTTATAGATCGCCCACGTAAGCATCGGAGCTCCGAGAGAATTATCCAAATCCACGGCGTCCCCTGCGACGCCGTCACCGCCTTCGTCGGATTCCTCTACTCCTCCAGGTGCACGGAGGAGGAGATGGACAAGTACGGGATGCACCTTCTTGCATTGTCGCACGTGTACATGGTGCCGCAGCTGAAGCAGAGGTGCATCAAGGGTTTGACCCACCGCTTGACCACGGAGAACGTGGTGGACGTGCTTCAACTCGCGCGTCTCTGTGACGCGCCGGATCTCCATCTTCGCTGCATGAAGCTCCTCGCCAACAATTTCAAAGCGGTGGAAGCAACGGAGGGGTGGAAGTTCCTCGTCAAACACGACCCCTGGCTCGAACTCGACATTCTCCGCTTCATCGACGAACACGAAACCAGGAAAAAGAAATCGAGGAAGTATAGGATGGAGCAGGGGCTATACGCGGAGCTGAGCGAGGCGATGGAGTGTTTGGAGCACATATGCTATGATGGGTGTACCCACGTTGGACCGCAATTTCAATTGAGAATGCAGCAAGAGAAACGGAAAGATGATGCTAAGTGGAAACTACTAGCGAGGAAGGTGGCCTCAGCCAAAGTCATGTCTTCATTGTCTCTGCCAAAGAGGAAGCGAGATGAAGAAACAAGAGTGAATATAAACAATCCCGGGATTAGAAGTTTTAAATTACTATGA

Predicted protein sequences of Glyma05g02863

Limit To All Plant Sequences

>Glyma05g02863.1   sequence type=predicted peptide   gene model=Glyma05g02863   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPQTISIHYHTTRFLPQPDVFIRTSHGTRIPAHAGILASMSPVFDNFIDRPRKHRSSERIIQIHGVPCDAVTAFVGFLYSSRCTEEEMDKYGMHLLALSHVYMVPQLKQRCIKGLTHRLTTENVVDVLQLARLCDAPDLHLRCMKLLANNFKAVEATEGWKFLVKHDPWLELDILRFIDEHETRKKKSRKYRMEQGLYAELSEAMECLEHICYDGCTHVGPQFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVNINNPGIRSFKLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain