SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g02800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g02800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g02800

Feature Type:gene_model
Chromosome:Gm05
Start:2139110
stop:2141905
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50250AT Annotation by Michelle Graham. TAIR10: chloroplast RNA-binding protein 31B | chr5:20452677-20453965 REVERSE LENGTH=289 SoyBaseE_val: 2.00E-104ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009451GO-bp Annotation by Michelle Graham. GO Biological Process: RNA modification SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0008266GO-mf Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding SoyBaseN/AISS
KOG0131 KOG Splicing factor 3b, subunit 4 JGI ISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF56Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_C6F119UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding protein n=2 Tax=Glycine max RepID=C6F119_SOYBN SoyBaseE_val: 5.00E-158ISS
UniRef100_UPI0001B63EADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001B63EAD related cluster n=1 Tax=unknown RepID=UPI0001B63EAD SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g02800 not represented in the dataset

Glyma05g02800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g13470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g043200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g02800.1   sequence type=CDS   gene model=Glyma05g02800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTATGATGTCTCTCACAACCGTGGCTGCATTCAAGTCCCTCACAATGGCGGAATCGTGCCTTCTATCCCTCCCTTCCCTCTTCTACGCCAAAAACAATACCCTTTCTCTCTCAATTCCCACCAAGCCCCTCAACCTCCATCTTCCATGCTCCAACTCTTCGCTCTTTCCCCTCACCACCAAAACAACGCGCCACTCTTCTCTCCTCACATTCGTGGCTCAGACATCGGATTGGGCCAAAGAAGAAGAGGAAGAAGAAACCTCGTGGGAGAACCAAGGCGACACCGCGTGGGGAACTGAAGAAGGTGGCCACGAAGAAGGGGGTTTCGCTGAAAAAGCTGAGGAAGATAAGATCTTCGTTGGGAACTTGCCTTTCGACATCGACAGCGAGAATTTGGCGTCGCTCTTCGGGCAGGCTGGCACCGTTGAGGTTGCTGAGGTTATTTATAATAGGGCCACTGACCGGAGTCGTGGGTTTGGATTTGTTACCATGAGTACACTTGAAGAGCTTAAGAAGGCTGTCGAGATGTTCAGTGGTTACGAACTAAATGGAAGAGTGTTGACTGTTAATAAGGCTGCTCCAAAAGGAGCACAGCCTGAACGCCCACCACGCCCACCACGTTCCTTTAGTTCTGGTTTAAGAGTCTATGTTGGCAACTTGCCATGGGAAGTTGACGATGCTCGGCTGGAGCAAATTTTCAGTGAACATGGTAAGGTTGAGGATGCTCGGGTGGTCTATGACAGAGAGACTGGTCGATCACGTGGTTTTGGCTTTGTCACAATGTCTAGTGAGACTGATATGAATGATGCAATTGCTGCCCTTGATGGTCAGAGTTTGGACGGGAGGGCTATCAGAGTGAATGTTGCACAGGATAGGCCTAGCCGCAGCTCTTTTTGA

>Glyma05g02800.1   sequence type=predicted peptide   gene model=Glyma05g02800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSMMSLTTVAAFKSLTMAESCLLSLPSLFYAKNNTLSLSIPTKPLNLHLPCSNSSLFPLTTKTTRHSSLLTFVAQTSDWAKEEEEEETSWENQGDTAWGTEEGGHEEGGFAEKAEEDKIFVGNLPFDIDSENLASLFGQAGTVEVAEVIYNRATDRSRGFGFVTMSTLEELKKAVEMFSGYELNGRVLTVNKAAPKGAQPERPPRPPRSFSSGLRVYVGNLPWEVDDARLEQIFSEHGKVEDARVVYDRETGRSRGFGFVTMSSETDMNDAIAALDGQSLDGRAIRVNVAQDRPSRSSF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo