SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g02781): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g02781): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g02781

Feature Type:gene_model
Chromosome:Gm05
Start:2123486
stop:2124209
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g02781
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39890AT Annotation by Michelle Graham. TAIR10: proline transporter 1 | chr2:16656022-16658202 FORWARD LENGTH=442 SoyBaseE_val: 2.00E-20ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
GO:0015193GO-mf Annotation by Michelle Graham. GO Molecular Function: L-proline transmembrane transporter activity SoyBaseN/AISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_F2Z8K2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proline transporter n=1 Tax=Elaeis guineensis RepID=F2Z8K2_ELAGV SoyBaseE_val: 1.00E-24ISS
UniRef100_I1K062UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1K062_SOYBN SoyBaseE_val: 6.00E-82ISS

Expression Patterns of Glyma05g02781
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g02781 not represented in the dataset
Glyma05g02781 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g02781 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g02781
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g02781
>Glyma05g02781.1   sequence type=CDS   gene model=Glyma05g02781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGTAGCACCAATTCATGAGGCATTGGACACTAAGTTCCTAGAAATTGACAAGGCCATGCATTCAGGGGAGAACTTGAAACGCTTATTTCTCCTACGTGCGCTTTTCTTTACAGGGAACACATTCGTTGCTGCAGCATTTCCTTTTATGGGTGACTTTGTAAACTTTCTTGGCTCATTTTCACTCGTTCCTCTGACCTTCATGTTCCCCAGCATGGTCTTCATCAAGGTTAAGGGAAGAACAGCTAGAATAGAGAAGAAGGCGTGGCACTGGTTCAACATCGTTTTTTCTTTTCTGCTCACAATAGCAACCACAATTTCAGCAATTCGGTTGATAGTCAACAACATCCAAAAGTATCATTTCTTTGCAGATGCATGA
Predicted protein sequences of Glyma05g02781
>Glyma05g02781.1   sequence type=predicted peptide   gene model=Glyma05g02781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFVAPIHEALDTKFLEIDKAMHSGENLKRLFLLRALFFTGNTFVAAAFPFMGDFVNFLGSFSLVPLTFMFPSMVFIKVKGRTARIEKKAWHWFNIVFSFLLTIATTISAIRLIVNNIQKYHFFADA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo