SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g02690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g02690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g02690

Feature Type:gene_model
Chromosome:Gm05
Start:2052777
stop:2054383
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50200AT Annotation by Michelle Graham. TAIR10: nitrate transmembrane transporters | chr5:20436612-20437535 FORWARD LENGTH=210 SoyBaseE_val: 7.00E-71ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0015112GO-mf Annotation by Michelle Graham. GO Molecular Function: nitrate transmembrane transporter activity SoyBaseN/AISS
UniRef100_D2KTV0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Component of high affinity nitrate transporter n=1 Tax=Lotus japonicus RepID=D2KTV0_LOTJA SoyBaseE_val: 2.00E-120ISS
UniRef100_I1K053UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K053_SOYBN SoyBaseE_val: 1.00E-151ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g02690 not represented in the dataset

Glyma05g02690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g13390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g042200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g02690.1   sequence type=CDS   gene model=Glyma05g02690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCACAAGGGCTTGTGGTAGTAGCATCACTTCTAATTTTCTGTTTAGCTGGAAGTTGCTATGGGAAGGTTCACTTCTCTACCTTGAAAAGAACCCTTGATGTCACCGCTTCCCCCAAGCAGGGACAAGTTCTGGAGGCTGGATTGGACAAAATCACAGTGACATGGGCATTGAACAAGACCTTACCTGCGGGGACAGACTCTGCCTACAAAACCATAAAGCTGAAGCTATGCTACGCGCCCATTAGCCAAAAGGACCGCGCGTGGAGAAAGACAGAGGATGAGCTGAACAGGGACAAGACATGCCAGCACAAGATCGTGGCCAAACCCTACGACGCTTCCAACAAAACCGTGCAGAGGTACGAGTGGCTGGTCGAGCGCGACGTGCCCAAAGCCACGTACTTCGTACGCGCCTACGCGTTCGACTCCAACGACGCGGAAGTGGCTTACGGCCAGACCACCGACGGCAAGAAGAGCACCAACCTGTTCGAGATCAATGCGGTGAGTGGGCGCCACGCGTCCCTCGATATCTGCTCCATTTGCTTCAGTGTTTTCTCCGTCGTTTCCCTCTTTTTCTTCTTCTATATCGAGAAAAGAAAGGGAAAGGCTTCTTCCTCAAAGTGA

>Glyma05g02690.1   sequence type=predicted peptide   gene model=Glyma05g02690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAQGLVVVASLLIFCLAGSCYGKVHFSTLKRTLDVTASPKQGQVLEAGLDKITVTWALNKTLPAGTDSAYKTIKLKLCYAPISQKDRAWRKTEDELNRDKTCQHKIVAKPYDASNKTVQRYEWLVERDVPKATYFVRAYAFDSNDAEVAYGQTTDGKKSTNLFEINAVSGRHASLDICSICFSVFSVVSLFFFFYIEKRKGKASSSK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo