Glyma05g02450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g02450

Feature Type:	gene_model
Chromosome:	Gm05
Start:	1793009
stop:	1793748
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g02450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G10790	AT	Annotation by Michelle Graham. TAIR10: UBX domain-containing protein \| chr4:6640752-6643035 REVERSE LENGTH=480	SoyBase	E_val: 2.00E-12	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
PTHR23322	Panther	FAS-ASSOCIATED PROTEIN	JGI		ISS
PTHR23322:SF15	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00789	PFAM	UBX domain	JGI		ISS
UniRef100_B9RAY4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: UBX domain-containing protein 8-B, putative n=1 Tax=Ricinus communis RepID=B9RAY4_RICCO	SoyBase	E_val: 4.00E-31	ISS
UniRef100_I1MTE9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MTE9_SOYBN	SoyBase	E_val: 1.00E-59	ISS

Expression Patterns of Glyma05g02450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g02450

Paralog	Evidence	Comments
Glyma17g09460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g02450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma05g02450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g02450

Limit To All Plant Sequences

>Glyma05g02450.1   sequence type=CDS   gene model=Glyma05g02450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGAGGGCTAAGCAGGAAGAAAAGATCCGAGCTGACCGTAGGCTCAGAGAAGAACAAGATGCTGCATATCTTGCAGCTTTACAAATTGACAAGAACAGCAAAGTGAATGAGTTCAATAAAGAAAAGGGAGACAAGGGAGTTGCTAGTAAAGGAAGCGAGTCTCAGCCCACACAGGTTCATATACTTGAGTCCTATACAACAAAGTTAATATCATGTCAAAGTTTAACTTGTATACTCATAAGGTTTCCAAACGGTGAAAGAAGAGAGCATACTTTCCTTTACACAAACAAAATCCAGTCCATTTTCTCATACATTGATTCATTAGCTTATGGCGTTGATCAAATGAGAATGACTCTCAAAGAGGCTGGCTTGTATCCTAAAGCTAGTGTATTTCTGGAGCCTTTAGGAACTAGAGTCCCTTAA

Predicted protein sequences of Glyma05g02450

Limit To All Plant Sequences

>Glyma05g02450.1   sequence type=predicted peptide   gene model=Glyma05g02450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ERAKQEEKIRADRRLREEQDAAYLAALQIDKNSKVNEFNKEKGDKGVASKGSESQPTQVHILESYTTKLISCQSLTCILIRFPNGERREHTFLYTNKIQSIFSYIDSLAYGVDQMRMTLKEAGLYPKASVFLEPLGTRVP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain