SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g02250

Feature Type:gene_model
Chromosome:Gm05
Start:1663202
stop:1663763
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g02250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16760AT Annotation by Michelle Graham. TAIR10: Inositol 1,3,4-trisphosphate 5/6-kinase family protein | chr5:5509890-5510849 FORWARD LENGTH=319 SoyBaseE_val: 2.00E-44ISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0052746GO-bp Annotation by Michelle Graham. GO Biological Process: inositol phosphorylation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
GO:0047325GO-mf Annotation by Michelle Graham. GO Molecular Function: inositol tetrakisphosphate 1-kinase activity SoyBaseN/AISS
GO:0052725GO-mf Annotation by Michelle Graham. GO Molecular Function: inositol-1,3,4-trisphosphate 6-kinase activity SoyBaseN/AISS
GO:0052726GO-mf Annotation by Michelle Graham. GO Molecular Function: inositol-1,3,4-trisphosphate 5-kinase activity SoyBaseN/AISS
PTHR14217Panther INOSITOL 1,3,4-TRIPHOSPHATE 5/6 KINASE JGI ISS
PF05770PFAM Inositol 1, 3, 4-trisphosphate 5/6-kinase JGI ISS
UniRef100_A7X665UniRef Annotation by Michelle Graham. Most informative UniRef hit: Inositol phosphate kinase n=1 Tax=Glycine max RepID=A7X665_SOYBN SoyBaseE_val: 2.00E-88ISS
UniRef100_UPI0002339E33UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339E33 related cluster n=1 Tax=unknown RepID=UPI0002339E33 SoyBaseE_val: 9.00E-115ISS

Expression Patterns of Glyma05g02250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g02250
ParalogEvidenceComments
Glyma17g09680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g02250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma05g02250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g02250
>Glyma05g02250.1   sequence type=CDS   gene model=Glyma05g02250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCGACCCCACCACACCCTTACAACAACAAGGCCCTTTCCACTGCATCATCTACAAACTCCACACCCCACACTGGAAAAACCAACTCCAACAATTCTCAACTAAATACCCAACCACCCAAGTGGTCGTGAACGAACCCAAACCCTTCGATTTTCACAAATTCCAAGAACTGGGCTTGCGGTTCCCGGTAATTGCGAAACCGTTGGCGGCTGACGGCGGCGCCGGCTCTCACGAGCTGCGCTTGGTCTTTGACGACGAGGGGCTCCACACGTTGAGCGTTCCGACGGTGCTGCAAGTTTTTGTGAACCACGGCGGGGTCGTATTCAAGATTTACGTTGCTGGGCAGCGCGTGAATTGCGTAAAGCGCAAGTCTTTGGGTGACATAACCGAAGAGAAGCTGAGAACGTTGAAGGGGTCGCTGCCATTTTCTCGTATGTCGAACTTGGGCGTTGAAGATCAGGATGGCGCCGTTGAGAACGCTGAAATGCCTCCGCAGGGTTTGGTG
Predicted protein sequences of Glyma05g02250
>Glyma05g02250.1   sequence type=predicted peptide   gene model=Glyma05g02250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IDPTTPLQQQGPFHCIIYKLHTPHWKNQLQQFSTKYPTTQVVVNEPKPFDFHKFQELGLRFPVIAKPLAADGGAGSHELRLVFDDEGLHTLSVPTVLQVFVNHGGVVFKIYVAGQRVNCVKRKSLGDITEEKLRTLKGSLPFSRMSNLGVEDQDGAVENAEMPPQGLV






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo