Report for Sequence Feature Glyma05g02250
Feature Type: gene_model
Chromosome: Gm05
Start: 1663202
stop: 1663763
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g02250
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G16760 AT
Annotation by Michelle Graham. TAIR10: Inositol 1,3,4-trisphosphate 5/6-kinase family protein | chr5:5509890-5510849 FORWARD LENGTH=319
SoyBase E_val: 2.00E-44 ISS
GO:0010264 GO-bp
Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process
SoyBase N/A ISS
GO:0052746 GO-bp
Annotation by Michelle Graham. GO Biological Process: inositol phosphorylation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0000287 GO-mf
Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0046872 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metal ion binding
SoyBase N/A ISS
GO:0047325 GO-mf
Annotation by Michelle Graham. GO Molecular Function: inositol tetrakisphosphate 1-kinase activity
SoyBase N/A ISS
GO:0052725 GO-mf
Annotation by Michelle Graham. GO Molecular Function: inositol-1,3,4-trisphosphate 6-kinase activity
SoyBase N/A ISS
GO:0052726 GO-mf
Annotation by Michelle Graham. GO Molecular Function: inositol-1,3,4-trisphosphate 5-kinase activity
SoyBase N/A ISS
PTHR14217 Panther
INOSITOL 1,3,4-TRIPHOSPHATE 5/6 KINASE
JGI ISS
PF05770 PFAM
Inositol 1, 3, 4-trisphosphate 5/6-kinase
JGI ISS
UniRef100_A7X665 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Inositol phosphate kinase n=1 Tax=Glycine max RepID=A7X665_SOYBN
SoyBase E_val: 2.00E-88 ISS
UniRef100_UPI0002339E33 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI0002339E33 related cluster n=1 Tax=unknown RepID=UPI0002339E33
SoyBase E_val: 9.00E-115 ISS
Expression Patterns of Glyma05g02250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g02250
Paralog Evidence Comments
Glyma17g09680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g02250 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma05g02250
Coding sequences of Glyma05g02250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g02250.1 sequence type=CDS gene model=Glyma05g02250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATCGACCCCACCACACCCTTACAACAACAAGGCCCTTTCCACTGCATCATCTACAAACTCCACACCCCACACTGGAAAAACCAACTCCAACAATTCTCAACTAAATACCCAACCACCCAAGTGGTCGTGAACGAACCCAAACCCTTCGATTTTCACAAATTCCAAGAACTGGGCTTGCGGTTCCCGGTAATTGCGAAACCGTTGGCGGCTGACGGCGGCGCCGGCTCTCACGAGCTGCGCTTGGTCTTTGACGACGAGGGGCTCCACACGTTGAGCGTTCCGACGGTGCTGCAAGTTTTTGTGAACCACGGCGGGGTCGTATTCAAGATTTACGTTGCTGGGCAGCGCGTGAATTGCGTAAAGCGCAAGTCTTTGGGTGACATAACCGAAGAGAAGCTGAGAACGTTGAAGGGGTCGCTGCCATTTTCTCGTATGTCGAACTTGGGCGTTGAAGATCAGGATGGCGCCGTTGAGAACGCTGAAATGCCTCCGCAGGGTTTGGTG
Predicted protein sequences of Glyma05g02250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g02250.1 sequence type=predicted peptide gene model=Glyma05g02250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
IDPTTPLQQQGPFHCIIYKLHTPHWKNQLQQFSTKYPTTQVVVNEPKPFDFHKFQELGLRFPVIAKPLAADGGAGSHELRLVFDDEGLHTLSVPTVLQVFVNHGGVVFKIYVAGQRVNCVKRKSLGDITEEKLRTLKGSLPFSRMSNLGVEDQDGAVENAEMPPQGLV