Report for Sequence Feature Glyma05g02110
Feature Type: gene_model
Chromosome: Gm05
Start: 1524972
stop: 1526196
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g02110
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G20970 AT
Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr4:11215259-11216212 FORWARD LENGTH=190
SoyBase E_val: 8.00E-27 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PF00010 PFAM
Helix-loop-helix DNA-binding domain
JGI ISS
UniRef100_B9RB43 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RB43_RICCO
SoyBase E_val: 1.00E-78 ISS
UniRef100_I1JZZ5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JZZ5_SOYBN
SoyBase E_val: 7.00E-112 ISS
Expression Patterns of Glyma05g02110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g02110
Paralog Evidence Comments
Glyma17g09810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g02110 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g036800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g02110
Coding sequences of Glyma05g02110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g02110.2 sequence type=CDS gene model=Glyma05g02110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAAAAACCAAACACTAGTACTAGTGGTTCACCAAAACTTGATCGCAAAACTATCGAAAGGAACCGCAGGATTCACATGAAATCTCTCTGCTTCAAGCTTGTTTCCACTATTCCTTCCAATGACCTCAAACCCACCAAGGACATGCTTTCCCAGCAGGATCAGCTTGATCTAGCAACCACGTACATAAAGCGTCTGAAGGAAAGAATAGAGAAACTGAAGGGGGAGAAGGAGAAAATCATGAACATGATGATGAGCTCAAACCAAAACAACAATAGCATTTTCAATATTGGCTCACAGTTGCCTCTACTTGAGATAAAGGACTTGGGTTCGGGCATTGAAGTGATGTTGATAAGTGGGTTAAATAAGAACTTCATGCTCTATGAAGTAATTAGTGTCCTCGAGGAAGAGGGTGCTGAAGTTGTCACTGCCAACTTCTCTACAGTTGCTGATAAGATTTTTTACACGGTTCATGCTCAGGTTAAAATATCAAGAGTTGGTGTTGAGCCAACGAGGGTATATCAAAGGCTTCAGGAGTTGATTGCACCACTAGAAATCTGGGAGTACATACCATGA
Predicted protein sequences of Glyma05g02110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g02110.2 sequence type=predicted peptide gene model=Glyma05g02110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKKPNTSTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNDLKPTKDMLSQQDQLDLATTYIKRLKERIEKLKGEKEKIMNMMMSSNQNNNSIFNIGSQLPLLEIKDLGSGIEVMLISGLNKNFMLYEVISVLEEEGAEVVTANFSTVADKIFYTVHAQVKISRVGVEPTRVYQRLQELIAPLEIWEYIP*