SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g01970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g01970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g01970

Feature Type:gene_model
Chromosome:Gm05
Start:1412812
stop:1415903
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g01970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48030AT Annotation by Michelle Graham. TAIR10: hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein | chr3:17725410-17727954 REVERSE LENGTH=349 SoyBaseE_val: 1.00E-37ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG4431 KOG Uncharacterized protein, induced by hypoxia JGI ISS
PTHR12297Panther HYPOXIA-INDUCBILE GENE 1 (HIG1)-RELATED JGI ISS
PF04588PFAM Hypoxia induced protein conserved region JGI ISS
UniRef100_C6T1P1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1P1_SOYBN SoyBaseE_val: 1.00E-48ISS
UniRef100_G7JNU1UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING-H2 finger protein ATL3I n=1 Tax=Medicago truncatula RepID=G7JNU1_MEDTR SoyBaseE_val: 2.00E-40ISS

Expression Patterns of Glyma05g01970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g01970 not represented in the dataset
Glyma05g01970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g01970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g035600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g01970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g01970
>Glyma05g01970.1   sequence type=CDS   gene model=Glyma05g01970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAAGATTATCTCCAAGAAGAGAAGAAGCGAGTTCGGAACCCTTTTGTCCCCATTGGTGCACTTGTTACTGCTGGTGTGCTAACGGCTGGCTTAATCAGTTTTAGACAAGGTAATTCTCAGTTAGGCCAGAAGTTAATGAGGGCTCGTGTGGTTGTCCAAGGTGCAACAGTGGCGCTCATGGTTGGCACTGCCTTTTATTATGGAGAAAATCCTTGGCGATCGAGTTAA
Predicted protein sequences of Glyma05g01970
>Glyma05g01970.1   sequence type=predicted peptide   gene model=Glyma05g01970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEDYLQEEKKRVRNPFVPIGALVTAGVLTAGLISFRQGNSQLGQKLMRARVVVQGATVALMVGTAFYYGENPWRSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo