SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g01920

Feature Type:gene_model
Chromosome:Gm05
Start:1388493
stop:1392619
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g01920
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48040AT Annotation by Michelle Graham. TAIR10: RHO-related protein from plants 10 | chr3:17731561-17733241 FORWARD LENGTH=208 SoyBaseE_val: 2.00E-129ISS
GO:0007015GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament organization SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009788GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0393 KOG Ras-related small GTPase, Rho type JGI ISS
PTHR24072Panther FAMILY NOT NAMED JGI ISS
PTHR24072:SF295Panther JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_B2MVQ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: ROP small G protein n=1 Tax=Medicago truncatula RepID=B2MVQ1_MEDTR SoyBaseE_val: 4.00E-139ISS
UniRef100_UPI00019A9EAAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00019A9EAA related cluster n=1 Tax=unknown RepID=UPI00019A9EAA SoyBaseE_val: 2.00E-153ISS

Expression Patterns of Glyma05g01920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g01920
ParalogEvidenceComments
Glyma17g09980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g01920 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g035200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g01920
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g01920
>Glyma05g01920.1   sequence type=CDS   gene model=Glyma05g01920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCAACAGCTTCAAGGTTTATCAAGTGTGTGACAGTTGGGGATGGAGCTGTAGGCAAAACTTGCATGCTCATTTGCTATACTAGCAACAAATTCCCCACGGACTATATTCCAACGGTGTTTGATAATTTCAGTGCAAATGTAGTTGTGGAAGGCACAACTGTCAATTTAGGCCTCTGGGACACTGCTGGACAAGAGGATTACAACAGACTGAGGCCTTTGAGCTACAGGGGGGCAGATGTCTTTGTCTTGGCTTTCTCTTTAGTCAGTCATGCAAGCTATGAAAATGTGTTGAAGAAGTGGGTTCCTGAACTGCAGCATTTTGCTCCCGGCATTCCAGTGGTGCTAGTTGGCACCAAATTGGATCTCCGAGAAGACAAGCACTATTTGGCTGATCATCCTGGTCTGGTGCCTGTGACTTCTGAGCAAGGTGAGGAATTGCGTAAACTGGTGGGAGCTACATATTATATAGAGTGCAGCTCAAAAACTCAGCAGAATGTGAAGTCAGTTTTTGATGCTGCTATAAAGGTGGTCATTAAGCCTCCACAAAAACAAGAGAAGAAAAAACCACGTCGAGGGTGTCTACTAAATGTCATCTGTGGAAGGAATATAGTTCGTTTTAAATGA
Predicted protein sequences of Glyma05g01920
>Glyma05g01920.1   sequence type=predicted peptide   gene model=Glyma05g01920   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSHASYENVLKKWVPELQHFAPGIPVVLVGTKLDLREDKHYLADHPGLVPVTSEQGEELRKLVGATYYIECSSKTQQNVKSVFDAAIKVVIKPPQKQEKKKPRRGCLLNVICGRNIVRFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo