SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g01640

Feature Type:gene_model
Chromosome:Gm05
Start:1127166
stop:1129401
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74840AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr1:28116201-28117317 REVERSE LENGTH=239 SoyBaseE_val: 9.00E-55ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR12374Panther TRANSCRIPTIONAL ADAPTOR 2 (ADA2)-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_D8L1Z5UniRef Annotation by Michelle Graham. Best UniRef hit: Isoflavonoid regulator n=1 Tax=Glycine max RepID=D8L1Z5_SOYBN SoyBaseE_val: 0ISS
UniRef100_D8L1Z5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isoflavonoid regulator n=1 Tax=Glycine max RepID=D8L1Z5_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g10250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g032200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g01640.1   sequence type=CDS   gene model=Glyma05g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTCGCGCCTCTTCCGCCGCCTCCGGCGAGATCATGCTGTTCGGGGTCAGAGTCGTCGTCGATTCGATGAGGAAGAGCGTCAGCATGAACAACCTCTCACAGTACGAACATCCTTTAGACGCCACCACCACCAACAACAACAAAGACGCCGTCGCCGCCGGCTACGCCTCCGCCGACGACGCCGCTCCTCAGAACTCCGGGCGCCACCGCGAGCGCGAGCGAAAGCGAGGAGTTCCGTGGACGGAGGAAGAACACAAGTTGTTTTTGGTTGGATTGCAGAAAGTAGGGAAAGGTGATTGGAGAGGAATCTCCAAAAACTACGTCAAAACGCGAACTCCGACGCAGGTTGCCAGCCATGCTCAGAAGTACTTTCTCCGACGAAGCAACCTCAATCGCCGTCGCCGTAGATCCAGCCTCTTTGACATCACCACCGACACGGTCTCTGCAATTCCGATGGAGGAAGAACAGGTCCAGAATCAAGACACCCTGTGTCATTCACAACAACAACCCGTGTTCCCTGCTGAAACTAGCAAAATCAATGGGTTTCCAGCGATGCCAGTGTATCAGTTTGGGGTTGGTTCTTCTGGAGTGATTTCAGTCCAAGGTACTGGAAACCCAATGGAAGAACTCACTCTGGGACAAGGAAACGTGGAAAAACACAATGTGCCAAACAAGGCCTCTACAGTGTCTGGTATCATCACCCCCGGTTCTTCTAGTTCTGCCATTGACCCACCACCGACACTGTCCCTGGGGCTATCCTTCTCATCTGACCAAAGACAGACATCATCAAGACATTCAGCTTTACATGCCATGCAATGTTTCAGCAATGGAGATAGCATCATTAGTGTTGCTTGA

>Glyma05g01640.1   sequence type=predicted peptide   gene model=Glyma05g01640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRASSAASGEIMLFGVRVVVDSMRKSVSMNNLSQYEHPLDATTTNNNKDAVAAGYASADDAAPQNSGRHRERERKRGVPWTEEEHKLFLVGLQKVGKGDWRGISKNYVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDTVSAIPMEEEQVQNQDTLCHSQQQPVFPAETSKINGFPAMPVYQFGVGSSGVISVQGTGNPMEELTLGQGNVEKHNVPNKASTVSGIITPGSSSSAIDPPPTLSLGLSFSSDQRQTSSRHSALHAMQCFSNGDSIISVA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo