SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g01590

Feature Type:gene_model
Chromosome:Gm05
Start:1084753
stop:1088567
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g01590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G59640AT Annotation by Michelle Graham. TAIR10: BIG PETAL P | chr1:21909464-21911030 REVERSE LENGTH=264 SoyBaseE_val: 4.00E-63ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0009694GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048446GO-bp Annotation by Michelle Graham. GO Biological Process: petal morphogenesis SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR12565Panther STEROL REGULATORY ELEMENT-BINDING PROTEIN JGI ISS
PTHR12565:SF7Panther CENTROMERE-BINDING PROTEIN 1, CBP-1 JGI ISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_B9R912UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9R912_RICCO SoyBaseE_val: 1.00E-71ISS
UniRef100_I1JZU4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZU4_SOYBN SoyBaseE_val: 4.00E-165ISS

Expression Patterns of Glyma05g01590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g01590
ParalogEvidenceComments
Glyma17g10290 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g01590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g031800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g01590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g01590
>Glyma05g01590.1   sequence type=CDS   gene model=Glyma05g01590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACCTCTTCTCTTCAACGACTCCACATTCTCTTCAGCTAACCCTTCTTTGTCTGAGATTTGGCCCTCTCATTTCCCCTCCGATCACACTCCCAGGAAGAGGCGCCTCTCCCCCTCGAGTGATTCTGCCAGCAATAAACATATCAAGTTATCAGCACCAGAATCCCAGGATCAAAACGGTGCGTTGAAGGTTGGTGAAGTAGACGCGACTTCCGTGGCCGGTAACAAGCTACCTCAACAAACCCCGAAACCTAGTTCTTCGGAGCAGGCACCTAAGCAAGACTATATACACGTGCGAGCCAGAAGAGGCCAAGCCACCGATAACCACAGTCTGGCTGAGAGAGCTAGAAGGGAAAAAATCAGTGAGAGGATGAAAATTCTTCAGGATTTAGTCCCCGGGTGCAACAAGGTAATTGGTAAAGCATTTGTGCTGGATGAGATAATTAATTATGTCCAGTCACTGCAACGTCAGGTTGAGTTCCTTTCAATGAAGCTTGAGGCAGTTAGTTCGAGATTGAGCATGAAGCCTACTCTTGAATGTTTTCCTTCAAAAGAAGTTTGCACTCAGGCCGGAATAATATTTGGATCACAACCGGCCAAGGGATATGCTCAAGGATCACAAATGGGATGGCTGCATATGCAGATAGCTGGTGGTTTTGAGAAAGCAACATAA
Predicted protein sequences of Glyma05g01590
>Glyma05g01590.1   sequence type=predicted peptide   gene model=Glyma05g01590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPLLFNDSTFSSANPSLSEIWPSHFPSDHTPRKRRLSPSSDSASNKHIKLSAPESQDQNGALKVGEVDATSVAGNKLPQQTPKPSSSEQAPKQDYIHVRARRGQATDNHSLAERARREKISERMKILQDLVPGCNKVIGKAFVLDEIINYVQSLQRQVEFLSMKLEAVSSRLSMKPTLECFPSKEVCTQAGIIFGSQPAKGYAQGSQMGWLHMQIAGGFEKAT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo