|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G69530 | AT | Annotation by Michelle Graham. TAIR10: expansin A1 | chr1:26142034-26143200 FORWARD LENGTH=245 | SoyBase | E_val: 3.00E-53 | ISS |
| GO:0006949 | GO-bp | Annotation by Michelle Graham. GO Biological Process: syncytium formation | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0009739 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus | SoyBase | N/A | ISS |
| GO:0009826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth | SoyBase | N/A | ISS |
| GO:0009828 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall loosening | SoyBase | N/A | ISS |
| GO:0010114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to red light | SoyBase | N/A | ISS |
| GO:0010119 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| PF03330 | PFAM | Rare lipoprotein A (RlpA)-like double-psi beta-barrel | JGI | ISS | |
| UniRef100_A6YRD8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Alpha-expansin 6 (Fragment) n=2 Tax=Gossypium RepID=A6YRD8_GOSBA | SoyBase | E_val: 4.00E-51 | ISS |
| UniRef100_I1JZN5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JZN5_SOYBN | SoyBase | E_val: 3.00E-56 | ISS |
|
Glyma05g00950 not represented in the dataset |
Glyma05g00950 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g025600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g00950.2 sequence type=CDS gene model=Glyma05g00950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCATGTTTATGGTGGTGCTTGTGGATATGGAAACCTGTATAGCCAGGGCTATGGGACTAACACGGCTGCTTTGAGCACGGCCTTGTTCAACAATGGTTCGAGCTGTGGAGCTTGCTTTGAGATAAAGTGTGCCAGTGACCAAAGGTGGTGCCATCCAGACACAGTTGTGGTCACTGCCACCAATTTTTGCTCACCAAACAATGCCCTCCCAAATGATGCAGGTGGCTGGTGCAACCCTCCCCTTCAACATTTTGATCTCTCTCAGCCTGTCTTCCAACAAATAGCTTAA
>Glyma05g00950.2 sequence type=predicted peptide gene model=Glyma05g00950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHVYGGACGYGNLYSQGYGTNTAALSTALFNNGSSCGACFEIKCASDQRWCHPDTVVVTATNFCSPNNALPNDAGGWCNPPLQHFDLSQPVFQQIA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||